Achromobacter insolitus: BUW96_22660 Help Entry BUW96_22660       CDS       T04671                                  Name (GenBank) acyl carrier protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism ais  Achromobacter insolitus Pathway ais00470   D-Amino acid metabolism ais00552   Teichoic acid biosynthesis ais01100   Metabolic pathways ais01503   Cationic antimicrobial peptide (CAMP) resistance ais02020   Two-component system Brite KEGG Orthology (KO) [BR:ais00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     BUW96_22660   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     BUW96_22660  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BUW96_22660  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     BUW96_22660  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:ais01504]     BUW96_22660 Enzymes [BR:ais01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      BUW96_22660 Antimicrobial resistance genes [BR:ais01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     BUW96_22660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GD_AH_second ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  APX77356 UniProt:  A0A6S7F5V2 LinkDB All DBs Position complement(4948966..4949205) Genome browser AA seq 79 aa AA seqDB search MHTEQELHTKIGEIVESIVMKKVTPDTQLIATGLVDSLAAVDITLAVESEYGCSIPAPEI AEHLQSVRTLAGYVAAHTS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcataccgagcaagaactccacaccaagatcggcgagatcgtcgagtcgatcgtcatg aagaaagtcacccccgatacgcaactgattgccacaggcctggtcgattcgctcgccgcc gtggacatcacgctggcggtcgagtcggagtacggttgcagcatcccggctcccgagatc gcggagcacctacagtcggtccgcacgcttgccggctatgtcgctgcccatacttcgtaa

DBGET integrated database retrieval system