KEGG   Histoplasma mississippiense: HCAG_02570
Entry
HCAG_02570        CDS       T02229                                 
Name
(RefSeq) cytochrome P450 55A3
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
aje  Histoplasma mississippiense
Pathway
aje00910  Nitrogen metabolism
aje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    HCAG_02570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aje00199]
    HCAG_02570
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     HCAG_02570
Cytochrome P450 [BR:aje00199]
 Cytochrome P450, fungi type
  CYP55 family
   HCAG_02570
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 5448914
NCBI-ProteinID: XP_001542399
UniProt: A6QYW3
LinkDB
AA seq 407 aa
MCVSPPKFPFSRPSGAIPPLEYAKLRATNPVSRVTLWDNSQPWLVVKHKDICSVLTDSRL
SKERTRAGFPEMNPGGKEAAKNRPTFVDMDPPDHGRQRNMVASLFTRESSETMRPHIQAT
ADALLDEIIKQGCEKPVDLVEKFALPLPSYIIYGILGVPKEDLAYLTECNAVRSNGSSTA
AAASNANKELLDYIGNLADKRLEKPGNDMISKLVVEQLKPGHIDRLDVIQIAFLMLVAGN
ATLVNMISLGIVTLLQHPKQLADLKGNPSLAPKFVEELCRYHTASAMATRRVAKEDIMLG
GHLIKAGEGIIAATQSGNRDEDIFPNPDVFDMHRTRGSEVALGYGYGEHVCVAEGLARTE
LEVVFFHHWSTNVLRLKPHKNSNTIPTTAELEARHPALRGQVFPSRR
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtgtgtctcgcctccaaaattccccttctctcgcccgtccggagctatcccgccgctg
gaatatgcgaaactcagagccacaaaccccgtgtccagagtcactctctgggacaacagt
cagccatggctggttgtcaaacataaggatatctgcagtgttctcacggattcacgtctg
tccaaggaacggacacgcgctggctttcccgaaatgaatcccggcggcaaggaggctgcc
aaaaaccgccctactttcgttgacatggaccctccagaccacgggcgtcaaaggaacatg
gttgcctcccttttcacaagggaatcttctgagacaatgcgcccgcatatccaagccact
gcagacgcccttctcgatgagataataaagcagggttgcgagaagcccgttgacttggtc
gagaagtttgctctaccgctgccatcctatatcatatacgggatcctgggtgtgccaaag
gaagatctggcatacctcactgagtgtaacgccgtccgtagtaatggaagttccaccgca
gcagctgcgtctaatgccaataaggaactcctggactacatcggcaacttggctgataag
cgacttgaaaagccaggaaacgatatgattagcaaacttgttgtggagcagcttaaaccg
ggccacatcgacagacttgatgtcatccaaatcgcctttttgatgcttgttgccggaaac
gccaccttggtgaacatgatttcgcttggcatcgtcacccttcttcaacatcccaaacaa
ctcgcagatctcaaaggcaatccatcactcgcacccaaattcgtcgaagagctctgtcgc
taccacacagcatcagcaatggccacgaggcgcgttgctaaagaggatatcatgcttggc
ggccatctcatcaaagcaggcgaaggtataattgccgccacccagtccggcaaccgagat
gaagacatcttccccaacccagacgtcttcgacatgcaccgcacgcgtggctctgaggta
gcgcttggctacggatatggcgagcatgtttgcgtcgctgagggactggctcgcaccgaa
cttgaggttgttttctttcatcactggtccactaacgtcttacgtcttaaaccccacaaa
aacagcaacactattccgacgactgccgaacttgaagctcggcatcccgctctccgaggt
caagtattcccctcccgacgctga

DBGET integrated database retrieval system