Acidovorax sp. JS42: Ajs_0495 Help Entry Ajs_0495          CDS       T00455                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ajs  Acidovorax sp. JS42 Pathway ajs00790   Folate biosynthesis ajs01100   Metabolic pathways ajs01240   Biosynthesis of cofactors Module ajs_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ajs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Ajs_0495 Enzymes [BR:ajs01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Ajs_0495  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Ajs_0495  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Ajs_0495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABM40746 UniProt:  A0A9J9KIY0 LinkDB All DBs Position complement(516756..517127) Genome browser AA seq 123 aa AA seqDB search MHTAAGTQILTLTGLRFDANLGILAHEKNAPQPIQVDAELNLGTQPLAPRDDDIQHVLDY RKVRQIIIDECTAEHVNLLESLIGKLANRLMQLPGVLGVRVKIAKLEIFDDCEVAIRVET GQW NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcacaccgccgccggcacccagatcctcacgctcaccggtttgcgcttcgacgcgaac ctgggcatcctcgcgcacgaaaaaaacgcgccccagcccatccaggtggacgccgagctg aacctgggcacccagcccctggcgccgcgcgacgacgacatccagcacgtgctggactac cgcaaggtgcgccagatcatcatcgacgagtgcacggccgagcatgtgaacctgctggag agcctgatcggcaagctggccaaccggctgatgcagctgcccggcgtgctgggcgtgcgc gtgaagatcgccaaactggaaatttttgatgactgcgaagtcgccattcgcgtcgagaca ggacagtggtaa

DBGET integrated database retrieval system