Acinonyx jubatus (cheetah): 106966345 Help Entry 106966345         CDS       T04657                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism aju  Acinonyx jubatus (cheetah) Pathway aju04010   MAPK signaling pathway aju04014   Ras signaling pathway aju04015   Rap1 signaling pathway aju04024   cAMP signaling pathway aju04062   Chemokine signaling pathway aju04510   Focal adhesion aju04517   IgSF CAM signaling aju04520   Adherens junction aju04611   Platelet activation aju04670   Leukocyte transendothelial migration aju04720   Long-term potentiation aju04722   Neurotrophin signaling pathway aju04934   Cushing syndrome aju04972   Pancreatic secretion aju05211   Renal cell carcinoma aju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106966345    04014 Ras signaling pathway     106966345    04015 Rap1 signaling pathway     106966345    04024 cAMP signaling pathway     106966345   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     106966345  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     106966345    04520 Adherens junction     106966345  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     106966345    04670 Leukocyte transendothelial migration     106966345    04062 Chemokine signaling pathway     106966345   09154 Digestive system    04972 Pancreatic secretion     106966345   09156 Nervous system    04720 Long-term potentiation     106966345    04722 Neurotrophin signaling pathway     106966345  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     106966345   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106966345   09167 Endocrine and metabolic disease    04934 Cushing syndrome     106966345  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     106966345    04031 GTP-binding proteins [BR:aju04031]     106966345 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106966345   Exosomal proteins of other body fluids (saliva and urine)    106966345   Exosomal proteins of colorectal cancer cells    106966345 GTP-binding proteins [BR:aju04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     106966345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  106966345 NCBI-ProteinID:  XP_026927095 UniProt:  A0A6J2AFD9 LinkDB All DBs Position B4:91718251..91729652 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagttgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcaaatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaat tgtgcattcttagaatcctccgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system