Acinonyx jubatus (cheetah): 106970698 Help Entry 106970698         CDS       T04657                                  Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04060   Cytokine-cytokine receptor interaction aju04151   PI3K-Akt signaling pathway aju04630   JAK-STAT signaling pathway aju04640   Hematopoietic cell lineage aju04657   IL-17 signaling pathway aju04658   Th1 and Th2 cell differentiation aju04659   Th17 cell differentiation aju04660   T cell receptor signaling pathway aju04664   Fc epsilon RI signaling pathway aju04672   Intestinal immune network for IgA production aju05140   Leishmaniasis aju05200   Pathways in cancer aju05310   Asthma aju05320   Autoimmune thyroid disease aju05321   Inflammatory bowel disease aju05330   Allograft rejection Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     106970698    04151 PI3K-Akt signaling pathway     106970698   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106970698  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     106970698    04660 T cell receptor signaling pathway     106970698    04658 Th1 and Th2 cell differentiation     106970698    04659 Th17 cell differentiation     106970698    04657 IL-17 signaling pathway     106970698    04664 Fc epsilon RI signaling pathway     106970698    04672 Intestinal immune network for IgA production     106970698  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106970698   09174 Infectious disease: parasitic    05140 Leishmaniasis     106970698   09163 Immune disease    05310 Asthma     106970698    05320 Autoimmune thyroid disease     106970698    05321 Inflammatory bowel disease     106970698    05330 Allograft rejection     106970698  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106970698    00536 Glycosaminoglycan binding proteins [BR:aju00536]     106970698 Cytokines and neuropeptides [BR:aju04052]  Cytokines   Interleukins    106970698 Glycosaminoglycan binding proteins [BR:aju00536]  Heparan sulfate / Heparin   Cytokines    106970698 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 HHH_9 Ribosomal_S19e AAR2 FAD_SOX Motif Other DBs NCBI-GeneID:  106970698 NCBI-ProteinID:  XP_014922851 UniProt:  A0A6I9ZLE3 LinkDB All DBs Position A1:108253572..108262162 Genome browser AA seq 133 aa AA seqDB search MDLTSQLIPALVCLLAFTSTFVHGQNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAP KNTSDKEIFCRATTVLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKSTLKDFLE RLKAIMQKKYSKH NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggatctcacctcccaactgattccagctctggtctgcttactagcatttaccagcacc ttcgtccacggccagaacttcaataatacgttgaaagagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcgtgcatggaactgaccgtcatggacgtcttggcagcccca aagaacacaagtgacaaggaaatcttctgcagagccacaaccgtgctccggcagatctat acacatcacaactgctccaccaaattcctcaaaggactcgacaggaacctcagcagcatg gcaaacaggacctgttctgtgaatgaagtcaagaagagtacactgaaagacttcttggaa aggctaaaagcgatcatgcaaaagaaatactcaaagcactga

DBGET integrated database retrieval system