Acinonyx jubatus (cheetah): 106970819 Help Entry 106970819         CDS       T04657                                  Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism aju  Acinonyx jubatus (cheetah) Pathway aju03260   Virion - Human immunodeficiency virus aju03264   Virion - Flavivirus and Alphavirus aju03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus aju03273   Virion - Lassa virus and SFTS virus aju04145   Phagocytosis aju04517   IgSF CAM signaling aju04625   C-type lectin receptor signaling pathway aju05152   Tuberculosis aju05162   Measles Brite KEGG Orthology (KO) [BR:aju00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     106970819    03264 Virion - Flavivirus and Alphavirus     106970819    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     106970819    03273 Virion - Lassa virus and SFTS virus     106970819  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     106970819  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     106970819  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106970819  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     106970819   09171 Infectious disease: bacterial    05152 Tuberculosis     106970819  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106970819   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:aju04054]     106970819    04515 Cell adhesion molecules [BR:aju04515]     106970819    04090 CD molecules [BR:aju04090]     106970819    04091 Lectins [BR:aju04091]     106970819 Membrane trafficking [BR:aju04131]  Endocytosis   Phagocytosis    C-lectin receptors     106970819 Pattern recognition receptors [BR:aju04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    106970819 Cell adhesion molecules [BR:aju04515]  Lectins   Selectins and C-type lectins    106970819 CD molecules [BR:aju04090]  Proteins   106970819 Lectins [BR:aju04091]  C-Type lectins   Asialoglycoprotein and DC receptors    106970819 SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Peptidase_S15 PPI_helical UL45 Motif Other DBs NCBI-GeneID:  106970819 NCBI-ProteinID:  XP_014922992 UniProt:  A0A6I9ZNR5 LinkDB All DBs Position 4 Genome browser AA seq 254 aa AA seqDB search MAEMCDPKEPDDPEVEVFGDQRLAKKYTGLLRSSRSLPGCLTQAHLPLLLLLVSLGFFML LVTTLVQVSRIHQSLQRDTGDHRERNHQESPGLGDVSQAQKQSSLEEILQQLTWMNATLA GLCRHCPWKWELFQGSCYFFSLTQNTWKESIAACQNMRAQLVVINSTEEQKFLKSWNTKN SQRTWIGLSDHHNEGSWRWVDDTPLQLSFWKEGEPNNHGDEDCVELYSDGWNDNRCSTEN FWICKKPSSPCPGL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atggcggagatgtgtgaccccaaggagccggatgaccccgaggtggaggtgtttggggac cagagactggctaagaaatacaccggcctgctcaggagctcacggagcctgccagggtgt ctgacccaggcccacctgcctctgctgctgcttctcgtctctctgggcttcttcatgctc ctggtgaccactctggttcaagtctccaggatccaccaatccctgcagagagacacaggg gaccatcgggagaggaaccatcaggagagccccggcctcggggatgtttctcaggcccag aaacaatcatccctggaggagatactccagcagctgacctggatgaatgccaccctggct ggcctgtgccgccactgcccctggaaatgggaacttttccagggaagctgctacttcttc tccctgacccagaacacctggaaagagtccatcgccgcgtgtcagaacatgagggcccag ctggtggtcatcaacagcactgaggagcagaaatttctgaagtcttggaatacgaaaaat agccagcgcacatggatcggcctcagtgaccaccacaatgagggttcttggagatgggtg gacgacactcccctccaactcagcttctggaaagaaggggaacccaacaaccacggggat gaggactgtgtggaattgtacagtgatggctggaatgacaacagatgtagtacagaaaac ttctggatctgtaagaagccctcgtccccctgcccgggcctctga

DBGET integrated database retrieval system