Acinonyx jubatus (cheetah): 106971305 Help Entry 106971305         CDS       T04657                                  Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism aju  Acinonyx jubatus (cheetah) Pathway aju03083   Polycomb repressive complex aju04010   MAPK signaling pathway aju05200   Pathways in cancer aju05202   Transcriptional misregulation in cancer aju05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:aju00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     106971305  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106971305  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106971305    05202 Transcriptional misregulation in cancer     106971305   09162 Cancer: specific types    05222 Small cell lung cancer     106971305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aju03000]     106971305    03036 Chromosome and associated proteins [BR:aju03036]     106971305 Transcription factors [BR:aju03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     106971305 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      106971305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  106971305 NCBI-ProteinID:  XP_026921730 UniProt:  A0A6J2A031 LinkDB All DBs Position B3:complement(109114365..109138998) Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataacgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatatcgatgacctcaagcggcagaatgctctcctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatggaggctcagactcc agctcggagtcggagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system