Acinonyx jubatus (cheetah): 106974355 Help Entry 106974355         CDS       T04657                                  Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism aju  Acinonyx jubatus (cheetah) Pathway aju01522   Endocrine resistance aju04010   MAPK signaling pathway aju04024   cAMP signaling pathway aju04210   Apoptosis aju04380   Osteoclast differentiation aju04620   Toll-like receptor signaling pathway aju04657   IL-17 signaling pathway aju04658   Th1 and Th2 cell differentiation aju04659   Th17 cell differentiation aju04660   T cell receptor signaling pathway aju04662   B cell receptor signaling pathway aju04668   TNF signaling pathway aju04713   Circadian entrainment aju04725   Cholinergic synapse aju04728   Dopaminergic synapse aju04915   Estrogen signaling pathway aju04917   Prolactin signaling pathway aju04921   Oxytocin signaling pathway aju04926   Relaxin signaling pathway aju04928   Parathyroid hormone synthesis, secretion and action aju04932   Non-alcoholic fatty liver disease aju04935   Growth hormone synthesis, secretion and action aju05031   Amphetamine addiction aju05132   Salmonella infection aju05133   Pertussis aju05135   Yersinia infection aju05140   Leishmaniasis aju05142   Chagas disease aju05161   Hepatitis B aju05162   Measles aju05166   Human T-cell leukemia virus 1 infection aju05167   Kaposi sarcoma-associated herpesvirus infection aju05170   Human immunodeficiency virus 1 infection aju05171   Coronavirus disease aju05200   Pathways in cancer aju05207   Chemical carcinogenesis - receptor activation aju05208   Chemical carcinogenesis - reactive oxygen species aju05210   Colorectal cancer aju05224   Breast cancer aju05231   Choline metabolism in cancer aju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aju05323   Rheumatoid arthritis aju05417   Lipid and atherosclerosis aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106974355    04668 TNF signaling pathway     106974355    04024 cAMP signaling pathway     106974355  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     106974355  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106974355    04660 T cell receptor signaling pathway     106974355    04658 Th1 and Th2 cell differentiation     106974355    04659 Th17 cell differentiation     106974355    04657 IL-17 signaling pathway     106974355    04662 B cell receptor signaling pathway     106974355   09152 Endocrine system    04915 Estrogen signaling pathway     106974355    04917 Prolactin signaling pathway     106974355    04921 Oxytocin signaling pathway     106974355    04926 Relaxin signaling pathway     106974355    04935 Growth hormone synthesis, secretion and action     106974355    04928 Parathyroid hormone synthesis, secretion and action     106974355   09156 Nervous system    04725 Cholinergic synapse     106974355    04728 Dopaminergic synapse     106974355   09158 Development and regeneration    04380 Osteoclast differentiation     106974355   09159 Environmental adaptation    04713 Circadian entrainment     106974355  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106974355    05207 Chemical carcinogenesis - receptor activation     106974355    05208 Chemical carcinogenesis - reactive oxygen species     106974355    05231 Choline metabolism in cancer     106974355    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106974355   09162 Cancer: specific types    05210 Colorectal cancer     106974355    05224 Breast cancer     106974355   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106974355    05170 Human immunodeficiency virus 1 infection     106974355    05161 Hepatitis B     106974355    05171 Coronavirus disease     106974355    05162 Measles     106974355    05167 Kaposi sarcoma-associated herpesvirus infection     106974355   09171 Infectious disease: bacterial    05132 Salmonella infection     106974355    05135 Yersinia infection     106974355    05133 Pertussis     106974355   09174 Infectious disease: parasitic    05140 Leishmaniasis     106974355    05142 Chagas disease     106974355   09163 Immune disease    05323 Rheumatoid arthritis     106974355   09165 Substance dependence    05031 Amphetamine addiction     106974355   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106974355    05418 Fluid shear stress and atherosclerosis     106974355   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     106974355   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     106974355  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aju03000]     106974355    04131 Membrane trafficking [BR:aju04131]     106974355 Transcription factors [BR:aju03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     106974355 Membrane trafficking [BR:aju04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     106974355 SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  106974355 NCBI-ProteinID:  XP_026921985 UniProt:  A0A6J2A0S1 LinkDB All DBs Position 7 Genome browser AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttctcagaccagagccccccacccctatggagtccccgcc ccctcagccggggcttactccagggctggagtcgtgaagaccgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacgctgcaagcggagacagaccaactagaagatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgacctgggcttcccggaagagatgtctgtggct tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc accttgcccctcctcaatgatcctgagcccaagccctccgtggagccggtcaagagcatc agcagcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcgtccagg cccagcggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagtagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system