Acinonyx jubatus (cheetah): 106983958 Help Entry 106983958         CDS       T04657                                  Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism aju  Acinonyx jubatus (cheetah) Pathway aju01523   Antifolate resistance aju04010   MAPK signaling pathway aju04060   Cytokine-cytokine receptor interaction aju04061   Viral protein interaction with cytokine and cytokine receptor aju04064   NF-kappa B signaling pathway aju04071   Sphingolipid signaling pathway aju04150   mTOR signaling pathway aju04210   Apoptosis aju04217   Necroptosis aju04350   TGF-beta signaling pathway aju04380   Osteoclast differentiation aju04612   Antigen processing and presentation aju04620   Toll-like receptor signaling pathway aju04621   NOD-like receptor signaling pathway aju04622   RIG-I-like receptor signaling pathway aju04625   C-type lectin receptor signaling pathway aju04640   Hematopoietic cell lineage aju04650   Natural killer cell mediated cytotoxicity aju04657   IL-17 signaling pathway aju04660   T cell receptor signaling pathway aju04664   Fc epsilon RI signaling pathway aju04668   TNF signaling pathway aju04920   Adipocytokine signaling pathway aju04930   Type II diabetes mellitus aju04931   Insulin resistance aju04932   Non-alcoholic fatty liver disease aju04933   AGE-RAGE signaling pathway in diabetic complications aju04936   Alcoholic liver disease aju04940   Type I diabetes mellitus aju05010   Alzheimer disease aju05014   Amyotrophic lateral sclerosis aju05020   Prion disease aju05022   Pathways of neurodegeneration - multiple diseases aju05132   Salmonella infection aju05133   Pertussis aju05134   Legionellosis aju05135   Yersinia infection aju05140   Leishmaniasis aju05142   Chagas disease aju05143   African trypanosomiasis aju05144   Malaria aju05145   Toxoplasmosis aju05146   Amoebiasis aju05152   Tuberculosis aju05160   Hepatitis C aju05161   Hepatitis B aju05163   Human cytomegalovirus infection aju05164   Influenza A aju05165   Human papillomavirus infection aju05166   Human T-cell leukemia virus 1 infection aju05168   Herpes simplex virus 1 infection aju05169   Epstein-Barr virus infection aju05170   Human immunodeficiency virus 1 infection aju05171   Coronavirus disease - COVID-19 aju05205   Proteoglycans in cancer aju05310   Asthma aju05321   Inflammatory bowel disease aju05322   Systemic lupus erythematosus aju05323   Rheumatoid arthritis aju05330   Allograft rejection aju05332   Graft-versus-host disease aju05410   Hypertrophic cardiomyopathy aju05414   Dilated cardiomyopathy aju05417   Lipid and atherosclerosis aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106983958    04350 TGF-beta signaling pathway     106983958    04064 NF-kappa B signaling pathway     106983958    04668 TNF signaling pathway     106983958    04071 Sphingolipid signaling pathway     106983958    04150 mTOR signaling pathway     106983958   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106983958    04061 Viral protein interaction with cytokine and cytokine receptor     106983958  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     106983958    04217 Necroptosis     106983958  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     106983958    04620 Toll-like receptor signaling pathway     106983958    04621 NOD-like receptor signaling pathway     106983958    04622 RIG-I-like receptor signaling pathway     106983958    04625 C-type lectin receptor signaling pathway     106983958    04650 Natural killer cell mediated cytotoxicity     106983958    04612 Antigen processing and presentation     106983958    04660 T cell receptor signaling pathway     106983958    04657 IL-17 signaling pathway     106983958    04664 Fc epsilon RI signaling pathway     106983958   09152 Endocrine system    04920 Adipocytokine signaling pathway     106983958   09158 Development and regeneration    04380 Osteoclast differentiation     106983958  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     106983958   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106983958    05170 Human immunodeficiency virus 1 infection     106983958    05161 Hepatitis B     106983958    05160 Hepatitis C     106983958    05171 Coronavirus disease - COVID-19     106983958    05164 Influenza A     106983958    05168 Herpes simplex virus 1 infection     106983958    05163 Human cytomegalovirus infection     106983958    05169 Epstein-Barr virus infection     106983958    05165 Human papillomavirus infection     106983958   09171 Infectious disease: bacterial    05132 Salmonella infection     106983958    05135 Yersinia infection     106983958    05133 Pertussis     106983958    05134 Legionellosis     106983958    05152 Tuberculosis     106983958   09174 Infectious disease: parasitic    05146 Amoebiasis     106983958    05144 Malaria     106983958    05145 Toxoplasmosis     106983958    05140 Leishmaniasis     106983958    05142 Chagas disease     106983958    05143 African trypanosomiasis     106983958   09163 Immune disease    05310 Asthma     106983958    05322 Systemic lupus erythematosus     106983958    05323 Rheumatoid arthritis     106983958    05321 Inflammatory bowel disease     106983958    05330 Allograft rejection     106983958    05332 Graft-versus-host disease     106983958   09164 Neurodegenerative disease    05010 Alzheimer disease     106983958    05014 Amyotrophic lateral sclerosis     106983958    05020 Prion disease     106983958    05022 Pathways of neurodegeneration - multiple diseases     106983958   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106983958    05418 Fluid shear stress and atherosclerosis     106983958    05410 Hypertrophic cardiomyopathy     106983958    05414 Dilated cardiomyopathy     106983958   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     106983958    04940 Type I diabetes mellitus     106983958    04936 Alcoholic liver disease     106983958    04932 Non-alcoholic fatty liver disease     106983958    04931 Insulin resistance     106983958    04933 AGE-RAGE signaling pathway in diabetic complications     106983958   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     106983958  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106983958    00536 Glycosaminoglycan binding proteins [BR:aju00536]     106983958 Cytokines and neuropeptides [BR:aju04052]  Cytokines   Tumor necrosis fators    106983958 Glycosaminoglycan binding proteins [BR:aju00536]  Heparan sulfate / Heparin   Cytokines    106983958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  106983958 NCBI-ProteinID:  XP_014937632 UniProt:  A0A6J0A5Z6 LinkDB All DBs Position B2:complement(119616586..119619506) Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT DNQLKVPSDGLYLIYSQVLFRGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcggcccccagagg gaagagctcccacatggcctgcaactaatcaaccctctgccccagacactcagatcatct tctcgaactccgagtgacaagccagtagcccatgtagtagcaaaccccgaagctgaaggg caactccagtggctgagccggcgtgccaatgccctcctggccaatggcgtggagctgaca gacaaccagctgaaggtgccctcagatgggctgtacctcatctactcccaggtcctcttc aggggccaaggatgtccttccacacatgtgctcctcacccacaccatcagccgctttgcc gtttcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag actccagagggggctgaggccaagccctggtatgagcccatctacctgggaggggtcttc caactggagaagggtgatcgactcagcgctgagatcaatctgcctgactatcttgacttt gccgagtctgggcaagtctactttggaatcattgccctgtga

DBGET integrated database retrieval system