Acinonyx jubatus (cheetah): 106984514 Help Entry 106984514         CDS       T04657                                  Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism aju  Acinonyx jubatus (cheetah) Pathway aju03082   ATP-dependent chromatin remodeling aju04015   Rap1 signaling pathway aju04145   Phagosome aju04210   Apoptosis aju04390   Hippo signaling pathway aju04510   Focal adhesion aju04520   Adherens junction aju04530   Tight junction aju04611   Platelet activation aju04613   Neutrophil extracellular trap formation aju04670   Leukocyte transendothelial migration aju04714   Thermogenesis aju04810   Regulation of actin cytoskeleton aju04814   Motor proteins aju04820   Cytoskeleton in muscle cells aju04919   Thyroid hormone signaling pathway aju04921   Oxytocin signaling pathway aju04971   Gastric acid secretion aju05014   Amyotrophic lateral sclerosis aju05100   Bacterial invasion of epithelial cells aju05132   Salmonella infection aju05135   Yersinia infection aju05164   Influenza A aju05205   Proteoglycans in cancer aju05225   Hepatocellular carcinoma aju05410   Hypertrophic cardiomyopathy aju05412   Arrhythmogenic right ventricular cardiomyopathy aju05414   Dilated cardiomyopathy aju05416   Viral myocarditis aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106984514  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     106984514    04390 Hippo signaling pathway     106984514  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106984514   09143 Cell growth and death    04210 Apoptosis     106984514   09144 Cellular community - eukaryotes    04510 Focal adhesion     106984514    04520 Adherens junction     106984514    04530 Tight junction     106984514   09142 Cell motility    04814 Motor proteins     106984514    04820 Cytoskeleton in muscle cells     106984514    04810 Regulation of actin cytoskeleton     106984514  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     106984514    04613 Neutrophil extracellular trap formation     106984514    04670 Leukocyte transendothelial migration     106984514   09152 Endocrine system    04921 Oxytocin signaling pathway     106984514    04919 Thyroid hormone signaling pathway     106984514   09154 Digestive system    04971 Gastric acid secretion     106984514   09159 Environmental adaptation    04714 Thermogenesis     106984514  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     106984514   09162 Cancer: specific types    05225 Hepatocellular carcinoma     106984514   09172 Infectious disease: viral    05164 Influenza A     106984514   09171 Infectious disease: bacterial    05132 Salmonella infection     106984514    05135 Yersinia infection     106984514    05100 Bacterial invasion of epithelial cells     106984514   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106984514   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106984514    05410 Hypertrophic cardiomyopathy     106984514    05412 Arrhythmogenic right ventricular cardiomyopathy     106984514    05414 Dilated cardiomyopathy     106984514    05416 Viral myocarditis     106984514  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:aju03021]     106984514    03019 Messenger RNA biogenesis [BR:aju03019]     106984514    03036 Chromosome and associated proteins [BR:aju03036]     106984514    03029 Mitochondrial biogenesis [BR:aju03029]     106984514   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aju04812]     106984514    04147 Exosome [BR:aju04147]     106984514 Transcription machinery [BR:aju03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      106984514 Messenger RNA biogenesis [BR:aju03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      106984514 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      106984514     NuA4 complex      106984514   Chromatin remodeling factors    BAF complex     106984514    PBAF complex     106984514    GBAF(ncBAF) complex     106984514    SWR1 complex     106984514 Mitochondrial biogenesis [BR:aju03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     106984514 Cytoskeleton proteins [BR:aju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      106984514 Exosome [BR:aju04147]  Exosomal proteins   Proteins found in most exosomes    106984514 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  106984514 NCBI-ProteinID:  XP_026898110 UniProt:  A0A6J1Y0U5 LinkDB All DBs Position E3:32154559..32157217 Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc ttcgcaggcgacgatgccccacgggccgtcttcccttccatcgtggggcgcccccggcac cagggcgtgatggtgggtatgggccagaaggactcctacgtgggcgatgaggcccagagc aagaggggcatcctgaccctgaagtaccccatcgagcacggtattgtcaccaactgggac gacatggagaagatctggcatcacactttctacaatgagctgcgtgtggcccccgaggag cacccagtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc cagatcatgttcgagaccttcaacaccccggccatgtacgtggccatccaggctgtgctg tccctgtacgcctctggccgcaccaccggcatcgtgatggactccggggacggggtcacc cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagcttc accaccaccgccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtggcc ttggacttcgagcaggagatggccaccgccgcgtcctcgtcctccctggagaagagctac gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg ctcttccagccttccttcctgggcatggaatcctgtggtatccacgaaactaccttcaac tccatcatgaagtgcgacgtcgacatccgcaaggacctctacgccaacacggtgctgtct ggggggaccaccatgtaccccggcatcgctgaccggatgcagaaggagatcaccgccctg gcgcccagcacgatgaagatcaagatcatcgcaccccctgagcgcaagtactccgtgtgg atcggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system