Acinonyx jubatus (cheetah): 106987399 Help Entry 106987399         CDS       T04657                                  Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism aju  Acinonyx jubatus (cheetah) Pathway aju03082   ATP-dependent chromatin remodeling aju04015   Rap1 signaling pathway aju04145   Phagosome aju04210   Apoptosis aju04390   Hippo signaling pathway aju04510   Focal adhesion aju04520   Adherens junction aju04530   Tight junction aju04611   Platelet activation aju04613   Neutrophil extracellular trap formation aju04670   Leukocyte transendothelial migration aju04714   Thermogenesis aju04810   Regulation of actin cytoskeleton aju04814   Motor proteins aju04820   Cytoskeleton in muscle cells aju04919   Thyroid hormone signaling pathway aju04921   Oxytocin signaling pathway aju04971   Gastric acid secretion aju05014   Amyotrophic lateral sclerosis aju05100   Bacterial invasion of epithelial cells aju05132   Salmonella infection aju05135   Yersinia infection aju05164   Influenza A aju05205   Proteoglycans in cancer aju05225   Hepatocellular carcinoma aju05410   Hypertrophic cardiomyopathy aju05412   Arrhythmogenic right ventricular cardiomyopathy aju05414   Dilated cardiomyopathy aju05416   Viral myocarditis aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106987399  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     106987399    04390 Hippo signaling pathway     106987399  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106987399   09143 Cell growth and death    04210 Apoptosis     106987399   09144 Cellular community - eukaryotes    04510 Focal adhesion     106987399    04520 Adherens junction     106987399    04530 Tight junction     106987399   09142 Cell motility    04814 Motor proteins     106987399    04820 Cytoskeleton in muscle cells     106987399    04810 Regulation of actin cytoskeleton     106987399  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     106987399    04613 Neutrophil extracellular trap formation     106987399    04670 Leukocyte transendothelial migration     106987399   09152 Endocrine system    04921 Oxytocin signaling pathway     106987399    04919 Thyroid hormone signaling pathway     106987399   09154 Digestive system    04971 Gastric acid secretion     106987399   09159 Environmental adaptation    04714 Thermogenesis     106987399  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     106987399   09162 Cancer: specific types    05225 Hepatocellular carcinoma     106987399   09172 Infectious disease: viral    05164 Influenza A     106987399   09171 Infectious disease: bacterial    05132 Salmonella infection     106987399    05135 Yersinia infection     106987399    05100 Bacterial invasion of epithelial cells     106987399   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106987399   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106987399    05410 Hypertrophic cardiomyopathy     106987399    05412 Arrhythmogenic right ventricular cardiomyopathy     106987399    05414 Dilated cardiomyopathy     106987399    05416 Viral myocarditis     106987399  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:aju03021]     106987399    03019 Messenger RNA biogenesis [BR:aju03019]     106987399    03036 Chromosome and associated proteins [BR:aju03036]     106987399    03029 Mitochondrial biogenesis [BR:aju03029]     106987399   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aju04812]     106987399    04147 Exosome [BR:aju04147]     106987399 Transcription machinery [BR:aju03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      106987399 Messenger RNA biogenesis [BR:aju03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      106987399 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      106987399     NuA4 complex      106987399   Chromatin remodeling factors    BAF complex     106987399    PBAF complex     106987399    GBAF(ncBAF) complex     106987399    SWR1 complex     106987399 Mitochondrial biogenesis [BR:aju03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     106987399 Cytoskeleton proteins [BR:aju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      106987399 Exosome [BR:aju04147]  Exosomal proteins   Proteins found in most exosomes    106987399 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  106987399 NCBI-ProteinID:  XP_026907943 UniProt:  A0A6J1YTE5 LinkDB All DBs Position E1:complement(58883887..58886736) Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaggagatcgccgcgctggtcatcgacaatggctctggcatgtgcaaggcgggc tttgctggggacgacgccccccgagccgtgttcccgtccatcgtcgggcggccccgacac cagggcgttatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc aagcggggcatcctgaccctcaagtaccccatcgaacacggcattgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgaggag cacccggtgctgctcactgaggcccccttgaaccccaaggccaaccgtgagaagatgact cagatcatgttcgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg tctctgtacgcttctggccgcaccactggtattgtcatggactctggggatggggtcacc cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagcttc accaccactgccgagcgggaaattgtgcgtgacatcaaggagaagctgtgctacgtggcc ctggattttgagcaggagatggccacggccgcgtcctcgtcctccctggagaagagctac gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg ctcttccagccttccttcctgggtatggagtcctgtggcatccacgagaccaccttcaac tccatcatgaagtgtgacgttgacatccggaaggacctctacgctaacacggtgctgtct ggcgggaccaccatgtaccccggcatcgccgacaggatgcagaaggagatcacagctctg gcgcccagcacgatgaagatcaagatcatcgctccccccgagcgcaagtactccgtgtgg atcgggggctccatcctggcgtcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system