Allobaculum sp. Allo2: KWG61_11840 Help Entry KWG61_11840       CDS       T08047                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism allo  Allobaculum sp. Allo2 Pathway allo00670   One carbon pool by folate allo00790   Folate biosynthesis allo01100   Metabolic pathways allo01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:allo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     KWG61_11840    00670 One carbon pool by folate     KWG61_11840  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     KWG61_11840 Enzymes [BR:allo01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      KWG61_11840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  UNT92777 LinkDB All DBs Position complement(2128812..2129069) Genome browser AA seq 85 aa AA seqDB search MIRLDAIAAVGRNGEIGWKGDMPWKRGLKQDLKFFRKVTMKRPVIMGCNTWKSLPGLLPG RLHLVLTSHEINREGVLTFPQSKTA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgatccgccttgacgccatcgccgcagtgggcagaaacggcgaaatcggctggaagggc gatatgccctggaagcgcggccttaaacaggatctgaagtttttccgtaaggtgacaatg aagcgcccggtcatcatgggctgcaacacgtggaagtcgctgcctggactgcttcccggc cgtcttcatcttgtgctcacgtcccatgaaatcaatcgcgaaggcgtgctgacctttcca cagtcgaagactgcctga

DBGET integrated database retrieval system