KEGG   Alcanivorax sp. NBRC 101098: AS19_10110
Entry
AS19_10110        CDS       T03879                                 
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln03030  DNA replication
aln03410  Base excision repair
aln03420  Nucleotide excision repair
aln03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aln00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AS19_10110
   03410 Base excision repair
    AS19_10110
   03420 Nucleotide excision repair
    AS19_10110
   03430 Mismatch repair
    AS19_10110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aln03032]
    AS19_10110
   03400 DNA repair and recombination proteins [BR:aln03400]
    AS19_10110
Enzymes [BR:aln01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     AS19_10110
DNA replication proteins [BR:aln03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     AS19_10110
DNA repair and recombination proteins [BR:aln03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     AS19_10110
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AS19_10110
   MMR (mismatch excision repair)
    DNA ligase
     AS19_10110
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AS19_10110
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT Nlig-Ia DNA_ligase_ZBD PTCB-BRCT RNA_ligase RNA_pol_A_CTD Rad9_Rad53_bind DUF4796_N
Other DBs
NCBI-ProteinID: BAP13862
LinkDB
Position
1098793..1101126
AA seq 777 aa
MTNNNDSSLQAQSLRDQLNDWSYRYYVQDDPAVPDAEYDRVFRALKDLEAQYPDLVTADS
PTQRVGDVPLDAFEQVQHEVPMLSLDNAFDDEELRAFDKRIRERLDVSEIIDYVAEPKLD
GLAVSLLYENGELVRAATRGDGQTGENITVNARTIRSVPLKLRGNDVPKRLEVRGEVVMP
HAGFEELNARQQEAGLKLFANPRNAAAGSLRQLDSRITASRPLEFYAYSMAQLEGWEHPP
THSAMLDALRDWGLRVNPEIRVCHGVEALLRFYQGILEKREHLDYDIDGVVYKVNRFDWQ
DDLGFVSRAPRWAIAHKFPAQEELTVLNGVDWQVGRTGALTPVARLEPVHVGGVIVSNAT
LHNIDEIQRLDIRIGDTVVVYRAGDVIPKVVRALPERRPANAQGIALPSSCPVCGSEILR
GHDQVVARCTGGLICGAQRREAIKHFASRRAMDIDGLGDKLVDALVDQELITTVADLYRL
KAEQVAGLERMGEKSADNLIAALEASKTVGLGRFLFALGILQIGEETAKNLADCFGDLDS
IRHAPLLLLLAVPDVGLEVAKAIGAFFAESDNEAVIDGLLAQGVSPQASGVPSAAFVKSL
TLAQLLKSAKRLGMNLEGIGDKSLDILGSHFPTVAELSAAAAEGAGAEPKGVRSGVMTQM
AKALAENDWRGRLQDAEKKVADMAARAPQEMESHPLEGQTWVLTGTLEQFTRNQAKQALQ
QLGAKVAGSVSKNTRTVVAGASAGSKLAKAESLGIEVCDEAALLSLLNQHGIDPGAL
NT seq 2334 nt   +upstreamnt  +downstreamnt
gtgacgaataacaacgattcttccctgcaagcacaatccctccgtgatcagcttaacgac
tggtcctaccgttactatgttcaagatgacccggcggtgccggatgcggagtacgatcgg
gtatttcgcgcactgaaagacctggaagcgcaataccctgatctagttaccgcagattcg
cccacccagcgggtgggtgatgtgccgttggatgcgtttgagcaggtgcagcatgaagtg
ccgatgttgagcctggacaatgccttcgatgatgaggagctacgggcctttgataagcgt
attcgtgaacgcttggatgtgagcgaaatcattgattacgtggccgagcccaagctcgac
gggttggcggtgtcgttgctttatgagaacggtgagttggtgcgggcggccacccgcggc
gatgggcaaaccggtgagaatattaccgtgaatgccagaactattcgctcggtgcctctt
aaactgcgtggcaatgatgtgcctaagcggttggaagtgcgcggtgaagtggtcatgccc
cacgctggctttgaggagcttaatgctcgccagcaagaggctgggctaaagctttttgct
aaccctcgtaatgccgcggcaggcagtttgcggcaattggattctcgcatcactgccagc
cgcccgctggaattttatgcctactccatggcccagctggaaggctgggagcatccgcct
acccattcggccatgcttgatgcattacgcgactggggtttacgcgtaaacccggagatt
cgtgtttgtcacggggtagaggccttgctgcgtttttatcagggcatcttggaaaaacgc
gagcatctggattacgacattgatggtgtggtgtacaaggtgaaccgcttcgactggcag
gatgacctgggctttgttagccgggcgccgcgctgggccatcgcccacaaatttcccgcc
caggaagagctcaccgtgctgaacggtgtggattggcaggtaggccgtaccggggcgctg
acgccggtggcgcggttggaaccggtgcacgtgggcggggtgatcgttagcaatgccacg
ctacacaatattgatgaaattcagcgcttggatattcgcattggcgataccgtggtggtg
taccgggccggcgatgtgattcccaaggtggtgcgggcactgccagagcgacgtccggca
aatgcacaaggcattgctttgccgtcgtcgtgcccggtgtgtggtagtgaaattctgcgt
ggccatgatcaagtggtggcgcgctgtaccggcggcttgatctgtggcgctcaacggcgt
gaagccatcaagcattttgcctcccgccgggccatggatattgatgggctgggtgacaag
ctagtggatgcgctggtggatcaggagctgattaccactgtggccgatctgtaccgcttg
aaagccgagcaggtggcgggcctggagcgcatgggggagaaatcggcggataatcttatt
gcggcgctggaagcctctaaaaccgtggggttaggccgcttcctgttcgcgctggggatc
ctacagattggtgaagaaaccgccaagaatctggctgactgttttggcgatctggatagc
attcgccatgctccgttgttgttgttgctggcggtgccggatgtgggtctggaagtggcc
aaggccatcggtgctttctttgccgaaagtgataacgaggcggtgatcgacggtttgttg
gcgcagggggtgagcccacaggccagcggagtaccgtctgctgcctttgtgaaaagcctg
acgttggcgcaattgttaaagtccgccaagcgattgggcatgaatcttgaagggattggt
gacaagtcactggacatcttgggtagccatttccccacggtcgctgaattgagtgcggcg
gcggctgaaggggccggcgccgaacccaagggcgtacgctccggggttatgacacagatg
gccaaggcgttggcggaaaatgactggcgaggccggctgcaggatgcggaaaaaaaggtt
gctgatatggctgcccgtgccccccaggaaatggaaagtcatcctttagaagggcagacc
tgggtactgaccgggacacttgagcagtttacccggaatcaggctaaacaggctctacag
cagctgggcgccaaagtggctgggtcggtgtctaaaaatactcgcacggtggtggcaggt
gcatctgcgggctccaaactggcgaaagcggaatcgttgggcattgaggtatgcgatgaa
gctgcgctactgtccctattgaaccagcacggtattgatccgggagcgttatga

DBGET integrated database retrieval system