Arabidopsis lyrata (lyrate rockcress): 9305488 Help Entry 9305488           CDS       T01578                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly00510   N-Glycan biosynthesis aly00513   Various types of N-glycan biosynthesis aly04141   Protein processing in endoplasmic reticulum Module aly_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:aly00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     9305488    00513 Various types of N-glycan biosynthesis     9305488  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     9305488 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 PRA1 LapA_dom DUF7315 Motif Other DBs NCBI-GeneID:  9305488 NCBI-ProteinID:  XP_002867390 UniProt:  D7MCI4 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MAAKPIASPIPVALYPTLSVFTLAIGLVITAIFFIYEATSSRKNRSLGKELATSAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcggcgaaaccgattgcgagtccgattccggtggctctgtatccgactttgtcggtg ttcactcttgcgattggcctcgtcattaccgctatcttcttcatctatgaagctacatca tccaggaaaaaccgaagcctcggaaaggagctcgctacttccgcagttgcatctgtcttc ttgggttttggatccttgtttctgctacttgctagtggtgtttatgtttga

DBGET integrated database retrieval system