Arabidopsis lyrata (lyrate rockcress): 9308017 Help Entry 9308017           CDS       T01578                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly03420   Nucleotide excision repair aly04120   Ubiquitin mediated proteolysis aly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     9308017    04120 Ubiquitin mediated proteolysis     9308017   09124 Replication and repair    03420 Nucleotide excision repair     9308017  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aly04121]     9308017    03400 DNA repair and recombination proteins [BR:aly03400]     9308017 Enzymes [BR:aly01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      9308017 Ubiquitin system [BR:aly04121]  Ubiquitin ligases (E3)   UBL E3 ligases    9308017   Multi subunit type E3    SCF complex     Ring finger protein      9308017    Cul2 complex      9308017    Cul3 complex      9308017    Cul4 complex      9308017    Cul7 complex      9308017    Cul8 complex      9308017    Cul9 complex      9308017 DNA repair and recombination proteins [BR:aly03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       9308017     TCR (transcription coupled repair) factors      Cul4-CSA complex       9308017 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  9308017 NCBI-ProteinID:  XP_020878286 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MANLDSDVTMIPAGEASSSVAASSFNKKAKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgaatctggactccgacgttaccatgattcctgccggagaagcctccagcagcgta gccgcttcgtctttcaacaagaaagctaagcgattcgagattaaaaagtggagcgccgtt gctctctgggcttgggatatcgttgttgacaactgtgcgatctgcagaaaccacatcatg gatctgtgcattgaatgtcaagctaatcaggctagtgctacaagtgaggaatgcactgtt gcttggggggtttgtaatcacgccttccactttcactgcatcagcagatggctaaagacc cgtcaagtttgtccattggataacagcgagtgggagtttcagaaatatggtcactaa

DBGET integrated database retrieval system