Anopheles maculipalpis: 126563362 Help Entry 126563362         CDS       T10890                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism amap  Anopheles maculipalpis Pathway amap03420   Nucleotide excision repair amap04120   Ubiquitin mediated proteolysis amap04141   Protein processing in endoplasmic reticulum amap04310   Wnt signaling pathway amap04341   Hedgehog signaling pathway - fly amap04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:amap00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126563362    04120 Ubiquitin mediated proteolysis     126563362   09124 Replication and repair    03420 Nucleotide excision repair     126563362  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     126563362    04341 Hedgehog signaling pathway - fly     126563362    04350 TGF-beta signaling pathway     126563362  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amap04121]     126563362    03400 DNA repair and recombination proteins [BR:amap03400]     126563362 Enzymes [BR:amap01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      126563362 Ubiquitin system [BR:amap04121]  Ubiquitin ligases (E3)   UBL E3 ligases    126563362   Multi subunit type E3    SCF complex     Ring finger protein      126563362    Cul2 complex      126563362    Cul3 complex      126563362    Cul4 complex      126563362    Cul7 complex      126563362    Cul8 complex      126563362    Cul9 complex      126563362 DNA repair and recombination proteins [BR:amap03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       126563362     TCR (transcription coupled repair) factors      Cul4-CSA complex       126563362 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Hydant_A_C Motif Other DBs NCBI-GeneID:  126563362 NCBI-ProteinID:  XP_050075955 LinkDB All DBs Position 3RL:complement(63152221..63152614) Genome browser AA seq 109 aa AA seqDB search MDIDEEEFEAPTSSSSRGERKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQAN QASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggatatcgacgaggaagagtttgaggcaccaacgtcgagcagtagccgaggtgagcgg aagcgtttcgaggtcaagaagtggaatgcggtagcgctgtgggcttgggacattgtggtg gacaactgtgccatctgccggaaccacatcatggatctttgtatagagtgccaggctaat caagcatcggccaccagtgaggaatgcacagttgcctggggagtttgtaaccatgcgttt cacttccactgtatctcccggtggctaaagacccggcaggtatgcccgctggacaataga gagtgggagttccagaagtacggccattaa

DBGET integrated database retrieval system