Apis mellifera (honey bee): 100578943 Help Entry 100578943         CDS       T01057                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ame  Apis mellifera (honey bee) Pathway ame00510   N-Glycan biosynthesis ame00513   Various types of N-glycan biosynthesis ame04141   Protein processing in endoplasmic reticulum Module ame_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ame00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100578943    00513 Various types of N-glycan biosynthesis     100578943  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100578943 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 CAAD TctB Pox_E2-like Pestivirus_E2 Motif Other DBs NCBI-GeneID:  100578943 NCBI-ProteinID:  XP_016772711 BEEBASE:  GB47754 UniProt:  A0A7M7IS61 LinkDB All DBs Position LG11:4407292..4408500 Genome browser AA seq 80 aa AA seqDB search MVEVESMTRYVSPINPAIFPLLAVVLLGIGIFFTAWFFVYEVTSTKFTRDMFKELLISLV AALFSGFGILFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggaagtcgaatctatgacaagatatgtctctcctattaatcctgcaatttttcca ttattggcagtggtattactaggaattggaatattctttacagcatggttttttgtatat gaagttactagtacaaaatttacaagggatatgttcaaagaattattaatttctttagtg gcagcattattttccggttttggtatattatttttacttctttgggttggaatttatgta tag

DBGET integrated database retrieval system