Apis mellifera (honey bee): 408691 Help Entry 408691            CDS       T01057                                  Name (RefSeq) RING-box protein 1A isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ame  Apis mellifera (honey bee) Pathway ame03420   Nucleotide excision repair ame04120   Ubiquitin mediated proteolysis ame04141   Protein processing in endoplasmic reticulum ame04310   Wnt signaling pathway ame04341   Hedgehog signaling pathway - fly ame04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ame00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     408691    04120 Ubiquitin mediated proteolysis     408691   09124 Replication and repair    03420 Nucleotide excision repair     408691  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     408691    04341 Hedgehog signaling pathway - fly     408691    04350 TGF-beta signaling pathway     408691  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ame04121]     408691    03400 DNA repair and recombination proteins [BR:ame03400]     408691 Enzymes [BR:ame01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      408691 Ubiquitin system [BR:ame04121]  Ubiquitin ligases (E3)   UBL E3 ligases    408691   Multi subunit type E3    SCF complex     Ring finger protein      408691    Cul2 complex      408691    Cul3 complex      408691    Cul4 complex      408691    Cul7 complex      408691    Cul8 complex      408691    Cul9 complex      408691 DNA repair and recombination proteins [BR:ame03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       408691     TCR (transcription coupled repair) factors      Cul4-CSA complex       408691 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  408691 NCBI-ProteinID:  XP_016766228 BEEBASE:  GB49812 UniProt:  A0A7M7IMQ5 LinkDB All DBs Position LG2:complement(11226149..11227681) Genome browser AA seq 113 aa AA seqDB search MASAMEIDDEESDLPTSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgtcggcaatggaaattgacgatgaagaaagtgatttaccaacttcgagtagtagt aaaggagaaaaaaaacgttttgaagtaaaaaagtggaatgctgtggctctatgggcatgg gatattgtagtagataattgcgcaatctgtcgtaatcatataatggatttatgtattgaa tgccaagcaaatcaagcatcagccactagtgaagaatgtaccgtagcttggggtgtatgc aatcatgcattccatttccattgcatctcacgttggttgaagactcgacaagtttgtcca cttgataatcgagagtgggagttccaaaaatacggtcattag

DBGET integrated database retrieval system