Apis mellifera (honey bee): 410280 Help Entry 410280            CDS       T01057                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism ame  Apis mellifera (honey bee) Pathway ame03008   Ribosome biogenesis in eukaryotes ame03013   Nucleocytoplasmic transport ame03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:ame00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     410280    03008 Ribosome biogenesis in eukaryotes     410280   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     410280  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ame03019]     410280    03009 Ribosome biogenesis [BR:ame03009]     410280    03016 Transfer RNA biogenesis [BR:ame03016]     410280    03036 Chromosome and associated proteins [BR:ame03036]     410280   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ame04147]     410280    04031 GTP-binding proteins [BR:ame04031]     410280 Messenger RNA biogenesis [BR:ame03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      410280 Ribosome biogenesis [BR:ame03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     410280   Pre-60S particles     410280 Transfer RNA biogenesis [BR:ame03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     410280 Chromosome and associated proteins [BR:ame03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      410280    Spindle formation proteins     410280 Exosome [BR:ame04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    410280 GTP-binding proteins [BR:ame04031]  Small (monomeric) G-proteins   Ran Family    Ran     410280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 RNA_helicase GTP_EFTU Gtr1_RagA AAA_24 ArgoMid AAA_16 AAA_7 Pox_A32 DUF5906 DUF5935 Motif Other DBs NCBI-GeneID:  410280 NCBI-ProteinID:  XP_006570503 BEEBASE:  GB43229 UniProt:  A0A7M7GYN2 LinkDB All DBs Position LG11:16196034..16198862 Genome browser AA seq 215 aa AA seqDB search MAQEADIPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLIFHTNRGPIRF NVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LLPPEVTMDPQWQQQIEKDLKEAQETALPEDDEDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcacaagaagctgatatacctactttcaaatgtgtattagtcggtgatggtggtact gggaaaacaacatttgtcaaacggcatttaaccggtgaatttgaaaaaaagtacgtcgca accttaggtgtggaggtacatccactcatctttcacacgaatcgtggtccaatccgtttc aacgtttgggatacagctggccaagaaaagtttggtggtttaagagacggatattatatt caaggacagtgtgccgtcattatgtttgatgttacatcgagagtaacgtacaaaaatgta cctaattggcatagagatttggttcgagtttgtgaaaatatacccattgtactttgcggg aataaagttgacattaaggataggaaagtaaaagcgaagagtatcgtgttccataggaag aagaatttacaatattacgacatcagtgcaaaaagcaactataattttgaaaaacctttc ttatggttggcacgtaaactgatcggtgatccaaatctcgaatttgtcgcaatgccagct cttcttccaccagaagttacaatggatccacaatggcagcaacagatcgagaaagatctt aaagaggctcaagagaccgcattaccagaagatgatgaagatctttag

DBGET integrated database retrieval system