Anopheles merus: 121593096 Help Entry 121593096         CDS       T08889                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism amer  Anopheles merus Pathway amer00510   N-Glycan biosynthesis amer00513   Various types of N-glycan biosynthesis amer04141   Protein processing in endoplasmic reticulum Module amer_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:amer00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     121593096    00513 Various types of N-glycan biosynthesis     121593096  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121593096 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF2269 Phage_holin_2_1 Motif Other DBs NCBI-GeneID:  121593096 NCBI-ProteinID:  XP_041771101 LinkDB All DBs Position 2L:complement(43870427..43871260) Genome browser AA seq 80 aa AA seqDB search MDLMVRYVSPVNPAVFPHLASVLLLFGTFFTAWFFVFEVSRPKQPSKESVIFKELSISLF ASLFLGFGVLFLLLSVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggatttgatggtacgctatgtgtcgccggtcaatccggccgtgtttccgcacctggcc agcgtgctgctgctgttcggcaccttcttcaccgcctggttcttcgtgttcgaggtgtcc cgcccgaagcaaccgtcgaaggagagcgtcatctttaaggagctgtcgatcagtctgttt gcctcgctgtttctcggcttcggtgtgctgtttctgctgctctcggtcgggatatacgtg taa

DBGET integrated database retrieval system