Anopheles merus: 121594544 Help Entry 121594544         CDS       T08889                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism amer  Anopheles merus Pathway amer03420   Nucleotide excision repair amer04120   Ubiquitin mediated proteolysis amer04141   Protein processing in endoplasmic reticulum amer04310   Wnt signaling pathway amer04341   Hedgehog signaling pathway - fly amer04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:amer00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121594544    04120 Ubiquitin mediated proteolysis     121594544   09124 Replication and repair    03420 Nucleotide excision repair     121594544  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121594544    04341 Hedgehog signaling pathway - fly     121594544    04350 TGF-beta signaling pathway     121594544  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amer04121]     121594544    03400 DNA repair and recombination proteins [BR:amer03400]     121594544 Enzymes [BR:amer01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121594544 Ubiquitin system [BR:amer04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121594544   Multi subunit type E3    SCF complex     Ring finger protein      121594544    Cul2 complex      121594544    Cul3 complex      121594544    Cul4 complex      121594544    Cul7 complex      121594544    Cul8 complex      121594544    Cul9 complex      121594544 DNA repair and recombination proteins [BR:amer03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121594544     TCR (transcription coupled repair) factors      Cul4-CSA complex       121594544 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Hydant_A_C zf-RING_16 Motif Other DBs NCBI-GeneID:  121594544 NCBI-ProteinID:  XP_041773853 UniProt:  A0A182V8J3 LinkDB All DBs Position 2L:17289963..17290773 Genome browser AA seq 109 aa AA seqDB search MDIDEEEFEAPTSSSSRGERKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQAN QASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggatatcgacgaggaagaattcgaggcaccgacgtccagcagcagccgaggtgagcgg aagcggttcgaggtcaagaagtggaacgcggtggccttgtgggcctgggacatcgtggtg gacaactgtgcgatctgccgaaatcacatcatggatctgtgcatcgagtgccaggcgaac caagcgtccgccaccagcgaggaatgtacggtggcttggggtgtgtgtaatcatgcgttc cacttccactgcatttcccgatggctgaagaccaggcaggtctgtccgctcgacaacaga gagtgggagttccagaagtacggtcattag

DBGET integrated database retrieval system