Astyanax mexicanus (Mexican tetra): 103021747 Help Entry 103021747         CDS       T05042                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04140   Autophagy - animal amex04150   mTOR signaling pathway amex04218   Cellular senescence amex04910   Insulin signaling pathway amex05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     103021747 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103021747 (rheb)   09143 Cell growth and death    04218 Cellular senescence     103021747 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103021747 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     103021747 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:amex04031]     103021747 (rheb) GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Ras Family    Rheb     103021747 (rheb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase RhoGAP_pG1_pG2 YebF ParE_toxin Reovirus_M2 AAA_14 Motif Other DBs NCBI-GeneID:  103021747 NCBI-ProteinID:  XP_049336666 LinkDB All DBs Position 6:24012327..24047710 Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVKVIHEKLLDMVGKVQVPIMLVGNK KDLHMERVISCEEGKALAESWNAAFMESSAKENQTAVEVFKRIILEAEKMDGGAPQGRTS CSLM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccaaagtctcgaaaaattgccgtcctgggctacagatccgtggggaagtcc tcattgacaatacagtttgtggaaggccagtttgtggactcatatgatccaaccatagaa aacacatttactaaaatgatcacagtcaatggccaagagtaccatctgcagctggtcgac acagcagggcaggatgaatactccattttccctcagacctattccatagatatcaatggt tacattttggtctattcagtcacctcaaataaaagttttgaagtagtaaaagttattcat gaaaaattgttggatatggtgggtaaagtacaagtacctataatgctggtgggaaataaa aaagatctacacatggagcgcgtcatcagttgtgaagaaggcaaagcgctggctgaatcg tggaacgcagcattcatggagtcctctgcgaaagagaaccagactgcagtcgaagtgttc aagaggataatcttagaggctgagaagatggacggtggagccccccaagggcggacatcc tgctcactgatgtag

DBGET integrated database retrieval system