Astyanax mexicanus (Mexican tetra): 103023232 Help Entry 103023232         CDS       T05042                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04010   MAPK signaling pathway amex04145   Phagocytosis amex04148   Efferocytosis amex04310   Wnt signaling pathway amex04370   VEGF signaling pathway amex04510   Focal adhesion amex04517   IgSF CAM signaling amex04518   Integrin signaling amex04519   Cadherin signaling amex04520   Adherens junction amex04530   Tight junction amex04620   Toll-like receptor signaling pathway amex04810   Regulation of actin cytoskeleton amex05100   Bacterial invasion of epithelial cells amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103023232    04310 Wnt signaling pathway     103023232    04370 VEGF signaling pathway     103023232   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103023232    04518 Integrin signaling     103023232    04519 Cadherin signaling     103023232  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     103023232    04148 Efferocytosis     103023232   09144 Cellular community - eukaryotes    04510 Focal adhesion     103023232    04520 Adherens junction     103023232    04530 Tight junction     103023232   09142 Cell motility    04810 Regulation of actin cytoskeleton     103023232  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103023232  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103023232    05100 Bacterial invasion of epithelial cells     103023232  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amex04131]     103023232   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103023232    04031 GTP-binding proteins [BR:amex04031]     103023232 Membrane trafficking [BR:amex04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103023232  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103023232   Macropinocytosis    Ras GTPases     103023232  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     103023232 Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103023232   Exosomal proteins of other body fluids (saliva and urine)    103023232   Exosomal proteins of colorectal cancer cells    103023232   Exosomal proteins of bladder cancer cells    103023232 GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103023232 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  103023232 NCBI-ProteinID:  XP_049322956 Ensembl:  ENSAMXG00000030572 LinkDB All DBs Position 18 Genome browser AA seq 193 aa AA seqDB search METIKCVLVGDKASEKTCLLITFTTNAFPKEYIPNVFDNYISTVMVDSRPFTLKLWDTAG QEDFDRLRPLSYPQTNVFIICFSISDPTSYDNVKLKWYPEVSHHCPNVPFLLVGTKMEER EDPTVLEELKEQKLTPITKQQGETLAQEIGAIKYFECSALQQVGVREVFVEAVRAFLIAN ANPVPPKQCCMLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggaaaccatcaagtgtgtgctagttggagataaagcttcagaaaagacctgtcttcta atcaccttcaccaccaatgccttccccaaggagtacatcccaaatgtgtttgacaactac atctcaactgtcatggtggattccagacccttcacccttaagctgtgggacacagcgggt caggaggactttgaccgactccgtcccttatcctacccacagactaatgtctttattata tgtttctccatctctgacccaacctcttatgataatgtcaagcttaagtggtatcctgag gtttcacatcactgccctaacgtacccttcctgctggtgggcacaaaaatggaagagcga gaagatccaacagttttagaagaactaaaagagcagaaattgactcctatcaccaagcag cagggggagacccttgctcaagaaattggagccataaaatattttgaatgctcggctcta cagcaagtcggagtcagggaggtatttgtggaggcggttcgtgccttcctgatagcaaac gcaaatcctgtccctcctaaacaatgctgtatgctgttataa

DBGET integrated database retrieval system