Astyanax mexicanus (Mexican tetra): 103026712 Help Entry 103026712         CDS       T05042                                  Symbol cxcl8a Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04060   Cytokine-cytokine receptor interaction amex04218   Cellular senescence amex04620   Toll-like receptor signaling pathway amex04621   NOD-like receptor signaling pathway amex04622   RIG-I-like receptor signaling pathway amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103026712 (cxcl8a)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103026712 (cxcl8a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103026712 (cxcl8a)    04621 NOD-like receptor signaling pathway     103026712 (cxcl8a)    04622 RIG-I-like receptor signaling pathway     103026712 (cxcl8a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103026712 (cxcl8a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amex04052]     103026712 (cxcl8a)    00536 Glycosaminoglycan binding proteins [BR:amex00536]     103026712 (cxcl8a) Cytokines and neuropeptides [BR:amex04052]  Cytokines   Chemokines    103026712 (cxcl8a) Glycosaminoglycan binding proteins [BR:amex00536]  Heparan sulfate / Heparin   Chemokines    103026712 (cxcl8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 MauE Motif Other DBs NCBI-GeneID:  103026712 NCBI-ProteinID:  XP_007229345 Ensembl:  ENSAMXG00000035755 UniProt:  A0A8B9R4X9 LinkDB All DBs Position 25:2305300..2308205 Genome browser AA seq 96 aa AA seqDB search MKRIVVCVSLLTVFFTLAEGMSLHGLGVEPRCRCSGTESRRIGKLIESIELFPPNPHCKD TEIIATLKSNGQEICLDPKAPWVTKVIEKILAKRSS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaagcgcatagttgtgtgcgtttctttactgacggtcttcttcactctggctgaaggt atgagtcttcatgggctgggtgtagaaccacggtgtcgctgcagtggaaccgaaagcaga cggatcggcaaactgatcgagagcatagagctcttccctccaaacccccactgcaaagac actgagatcattgcgacattgaagagcaacggtcaggagatctgtctggatcctaaagca ccttgggtcacaaaagtgattgagaagattttggccaagcggtcatcgtaa

DBGET integrated database retrieval system