Astyanax mexicanus (Mexican tetra): 103027563 Help Entry 103027563         CDS       T05042                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04010   MAPK signaling pathway amex04137   Mitophagy - animal amex04140   Autophagy - animal amex04218   Cellular senescence amex04371   Apelin signaling pathway amex04625   C-type lectin receptor signaling pathway amex04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103027563 (rras2)    04371 Apelin signaling pathway     103027563 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103027563 (rras2)    04137 Mitophagy - animal     103027563 (rras2)   09143 Cell growth and death    04218 Cellular senescence     103027563 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103027563 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103027563 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103027563 (rras2)    04031 GTP-binding proteins [BR:amex04031]     103027563 (rras2) Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103027563 (rras2)   Exosomal proteins of bladder cancer cells    103027563 (rras2) GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103027563 (rras2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  103027563 NCBI-ProteinID:  XP_007239396 Ensembl:  ENSAMXG00000034061 UniProt:  A0A8B9HE76 A0A3B1IP38 LinkDB All DBs Position 16:40573971..40644883 Genome browser AA seq 203 aa AA seqDB search MAAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERP ARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFP MILVGNKADLEQQRQVSQDEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQ ECPPSPEPTRKEKDKSGCHCVIV NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggctgcgggctggaaggacggctccgtgcaggagaagtaccgcctggtggtggtcgga ggcggcggcgtcggaaagtcggcgctcacgatacagttcatccagtcgtacttcgtcacg gactatgaccccacgattgaagactcgtacacaaagcagtgcgtgatcgacgagaggccg gcgcggctggacattctggacacggctgggcaggaagagtttggggccatgagagaacaa tacatgagaacaggggagggcttcctactcgtcttctctgtcaccgaccggggaagcttt gaagaaatctacaaattccaaagacagatcctgagggtgaaggaccgggatgaatttccc atgatcctcgtgggcaacaaggctgacctcgagcagcagagacaggtgtctcaggacgag gggcagcagctggcgcggcagctgaaagtcacgtacatggaggcttcagccaagatccgc atgaatgtagaccaggctttccacgagctggtccgagtcattaggaagttccaggagcag gagtgcccgccttcaccggagcccacgcgcaaagagaaggacaagagcggctgccactgc gtcatcgtctga

DBGET integrated database retrieval system