Astyanax mexicanus (Mexican tetra): 103028862 Help Entry 103028862         CDS       T05042                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04517   IgSF CAM signaling amex04814   Motor proteins amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103028862 (dynll2a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103028862 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103028862 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:amex03037]     103028862 (dynll2a)    04812 Cytoskeleton proteins [BR:amex04812]     103028862 (dynll2a) Cilium and associated proteins [BR:amex03037]  Motile cilia and associated proteins   Dynein arm    103028862 (dynll2a) Cytoskeleton proteins [BR:amex04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103028862 (dynll2a) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  103028862 NCBI-ProteinID:  XP_007248693 Ensembl:  ENSAMXG00000029047 UniProt:  A0A3B1IS75 A0A8B9KB05 LinkDB All DBs Position 18:complement(13284887..13289445) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacagaaaagctgtgatcaagaacgctgacatgtctgaggacatgcagcaggac gcagtcgactgtgcaacacaggcaatggagaagtacaacatagagaaggacatcgcagcg tacatcaaaaaggagtttgacaagaagtacaacccaacttggcactgcattgtgggcagg aacttcggcagttacgtcacccacgagacgaagcacttcatctacttctacctgggccag gtggccatactcttgttcaaatctggctga

DBGET integrated database retrieval system