Astyanax mexicanus (Mexican tetra): 103028862 Help Entry 103028862         CDS       T05042                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04814   Motor proteins amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103028862 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103028862 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:amex03037]     103028862 (dynll2a)    04812 Cytoskeleton proteins [BR:amex04812]     103028862 (dynll2a) Cilium and associated proteins [BR:amex03037]  Motile cilia and associated proteins   Dynein arm    103028862 (dynll2a) Cytoskeleton proteins [BR:amex04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103028862 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  103028862 NCBI-ProteinID:  XP_007248693 Ensembl:  ENSAMXG00000029047 UniProt:  A0A3B1IS75 A0A8B9KB05 LinkDB All DBs Position 18:complement(13284887..13289445) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacagaaaagctgtgatcaagaacgctgacatgtctgaggacatgcagcaggac gcagtcgactgtgcaacacaggcaatggagaagtacaacatagagaaggacatcgcagcg tacatcaaaaaggagtttgacaagaagtacaacccaacttggcactgcattgtgggcagg aacttcggcagttacgtcacccacgagacgaagcacttcatctacttctacctgggccag gtggccatactcttgttcaaatctggctga

DBGET integrated database retrieval system