Astyanax mexicanus (Mexican tetra): 103029431 Help Entry 103029431         CDS       T05042                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04081   Hormone signaling amex04144   Endocytosis amex04150   mTOR signaling pathway amex04270   Vascular smooth muscle contraction amex04310   Wnt signaling pathway amex04350   TGF-beta signaling pathway amex04510   Focal adhesion amex04517   IgSF CAM signaling amex04519   Cadherin signaling amex04520   Adherens junction amex04530   Tight junction amex04621   NOD-like receptor signaling pathway amex04625   C-type lectin receptor signaling pathway amex04810   Regulation of actin cytoskeleton amex05100   Bacterial invasion of epithelial cells amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103029431    04350 TGF-beta signaling pathway     103029431    04150 mTOR signaling pathway     103029431   09133 Signaling molecules and interaction    04081 Hormone signaling     103029431    04517 IgSF CAM signaling     103029431    04519 Cadherin signaling     103029431  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103029431   09144 Cellular community - eukaryotes    04510 Focal adhesion     103029431    04520 Adherens junction     103029431    04530 Tight junction     103029431   09142 Cell motility    04810 Regulation of actin cytoskeleton     103029431  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103029431    04625 C-type lectin receptor signaling pathway     103029431   09153 Circulatory system    04270 Vascular smooth muscle contraction     103029431  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103029431    05100 Bacterial invasion of epithelial cells     103029431  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amex04131]     103029431   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103029431    04031 GTP-binding proteins [BR:amex04031]     103029431 Membrane trafficking [BR:amex04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103029431 Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103029431   Exosomal proteins of other body fluids (saliva and urine)    103029431   Exosomal proteins of colorectal cancer cells    103029431   Exosomal proteins of bladder cancer cells    103029431 GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103029431 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103029431 NCBI-ProteinID:  XP_022538257 Ensembl:  ENSAMXG00000036616 LinkDB All DBs Position 24:31238179..31244986 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIYAFGYMECSAKTKDGVREVFEMATRAALQ ARKGKKGTKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaattcgtaagaagctggtgatcgttggagatggggcttgcggaaagacctgc cttctcatcgtcttcagcaaagaccagttccctgaagtttatgtgcctacagtgttcgag aactacgtggccgacatcgaggtggatggcaaacaggttgagcttgccttgtgggataca gccggccaggaggactacgatcggctacgtccgctctcctatcccgacactgacgtcatt ctgatgtgcttctccatcgacagcccagacagtcttgagaacattccagaaaaatggact cctgaagtgaaacacttctgtcccaacgtccccatcatcctggtgggcaacaagaaggac ctgcgtaacgatgagcacacccgccgcgagctggccaagatgaagcaggaaccagtcaaa ccagaggagggcagagacatggccaaccgaatctacgccttcggatacatggagtgctct gccaagacgaaggacggcgtgagggaggtgttcgaaatggccaccagggcggcgctgcag gccagaaagggcaagaagggcaccaaatgcctcctactgtaa

DBGET integrated database retrieval system