Astyanax mexicanus (Mexican tetra): 103029988 Help Entry 103029988         CDS       T05042                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04060   Cytokine-cytokine receptor interaction amex04218   Cellular senescence amex04620   Toll-like receptor signaling pathway amex04621   NOD-like receptor signaling pathway amex04622   RIG-I-like receptor signaling pathway amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103029988  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103029988  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103029988    04621 NOD-like receptor signaling pathway     103029988    04622 RIG-I-like receptor signaling pathway     103029988  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103029988  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amex04052]     103029988    00536 Glycosaminoglycan binding proteins [BR:amex00536]     103029988 Cytokines and neuropeptides [BR:amex04052]  Cytokines   Chemokines    103029988 Glycosaminoglycan binding proteins [BR:amex00536]  Heparan sulfate / Heparin   Chemokines    103029988 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103029988 NCBI-ProteinID:  XP_007238762 UniProt:  A0A8T2KSU1 LinkDB All DBs Position 22:complement(17448842..17451355) Genome browser AA seq 107 aa AA seqDB search MQFSARLLLLAATALCCFPTLFAFLATSPQCRCVNTSRSPMSSQHFKSLQIFPPTAHCRN TEILITQKNGITVCVDPEVNWIKPIIEKVLKRSKRRAESPVQTKTSS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcagttcagtgcccgtcttctgctgctggcagccactgctctctgctgctttcccaca ctatttgcatttctggccactagccctcaatgtcgctgtgtgaacaccagtagatcccct atgagttcccagcacttcaagagccttcagatctttcctcctactgcccactgccgcaac actgaaatcctgatcacccagaagaatggtattacagtgtgtgtggaccctgaagtaaac tggatcaagcccatcatcgagaaagttttaaagagaagcaaaagacgtgcagagtctcca gtgcaaaccaaaacatcttcttaa

DBGET integrated database retrieval system