Astyanax mexicanus (Mexican tetra): 103034468 Help Entry 103034468         CDS       T05042                                  Symbol cdc42l2 Name (RefSeq) cell division cycle 42 like 2   KO K04393   cell division control protein 42 Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04010   MAPK signaling pathway amex04144   Endocytosis amex04370   VEGF signaling pathway amex04510   Focal adhesion amex04517   IgSF CAM signaling amex04518   Integrin signaling amex04520   Adherens junction amex04530   Tight junction amex04810   Regulation of actin cytoskeleton amex04912   GnRH signaling pathway amex05100   Bacterial invasion of epithelial cells amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103034468 (cdc42l2)    04370 VEGF signaling pathway     103034468 (cdc42l2)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103034468 (cdc42l2)    04518 Integrin signaling     103034468 (cdc42l2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103034468 (cdc42l2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103034468 (cdc42l2)    04520 Adherens junction     103034468 (cdc42l2)    04530 Tight junction     103034468 (cdc42l2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103034468 (cdc42l2)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     103034468 (cdc42l2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103034468 (cdc42l2)    05100 Bacterial invasion of epithelial cells     103034468 (cdc42l2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amex04131]     103034468 (cdc42l2)    03036 Chromosome and associated proteins [BR:amex03036]     103034468 (cdc42l2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103034468 (cdc42l2)    04031 GTP-binding proteins [BR:amex04031]     103034468 (cdc42l2) Membrane trafficking [BR:amex04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103034468 (cdc42l2)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     103034468 (cdc42l2)   Macropinocytosis    Ras GTPases     103034468 (cdc42l2) Chromosome and associated proteins [BR:amex03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     103034468 (cdc42l2) Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of microglial cells    103034468 (cdc42l2)   Exosomal proteins of breast milk    103034468 (cdc42l2) GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103034468 (cdc42l2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  103034468 NCBI-ProteinID:  XP_007250068 UniProt:  A0A8B9LYZ4 A0A3B1IZC6 LinkDB All DBs Position 13:complement(32304072..32311735) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccattaaatgtgtagtagttggggatggtgctgtgggtaaaacctgccttttg atttcatatacgacaaacaagttcccatcagagtatgtaccaacagtttttgataactat gccgtaactgtaatgattgggggtgaaccatacactcttggattatttgacactgcaggc caggaggattatgatcggttgaggcctctgagctacccccaaaccgatgtcttcttagtt tgtttctcagtagtttcaccctcatcctttgaaaatgtcaaggaaaaatgggtgcctgag atcacccaccactgtccaaagaccccgttcctgttggtcggaactcagattgacttgaga gacgatccttctactattgaaaagcttgcaaagaacaagcagaaacccatcactcctgaa acagcagagaaactagcgagagacttgaaagcagtcaaatatgtggaatgttcagcttta acacagaaagggctgaagaacgtatttgatgaggccatactagctgccttggagccccca gagcctaagaagaaacgtaaatgtgttcttttatga

DBGET integrated database retrieval system