Astyanax mexicanus (Mexican tetra): 103035456 Help Entry 103035456         CDS       T05042                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04081   Hormone signaling amex04144   Endocytosis amex04150   mTOR signaling pathway amex04270   Vascular smooth muscle contraction amex04310   Wnt signaling pathway amex04350   TGF-beta signaling pathway amex04510   Focal adhesion amex04520   Adherens junction amex04530   Tight junction amex04621   NOD-like receptor signaling pathway amex04625   C-type lectin receptor signaling pathway amex04810   Regulation of actin cytoskeleton amex05100   Bacterial invasion of epithelial cells amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103035456 (rhoca)    04350 TGF-beta signaling pathway     103035456 (rhoca)    04150 mTOR signaling pathway     103035456 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     103035456 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103035456 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103035456 (rhoca)    04520 Adherens junction     103035456 (rhoca)    04530 Tight junction     103035456 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103035456 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103035456 (rhoca)    04625 C-type lectin receptor signaling pathway     103035456 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103035456 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103035456 (rhoca)    05100 Bacterial invasion of epithelial cells     103035456 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amex04131]     103035456 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103035456 (rhoca)    04031 GTP-binding proteins [BR:amex04031]     103035456 (rhoca) Membrane trafficking [BR:amex04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103035456 (rhoca) Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103035456 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    103035456 (rhoca)   Exosomal proteins of colorectal cancer cells    103035456 (rhoca)   Exosomal proteins of bladder cancer cells    103035456 (rhoca) GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103035456 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103035456 NCBI-ProteinID:  XP_007253416 Ensembl:  ENSAMXG00000044075 UniProt:  A0A8B9H470 A0A3B1JUL7 LinkDB All DBs Position 5:complement(11979989..11994922) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQ VRKKRKRSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcggccataaggaaaaagctggtgatcgtgggcgatggagcatgtggaaagacctgt ctgctcatagtattcagtaaagaccagttccctgaagtttatgttcccactgtgtttgag aactacattgcggacattgaggtggatggcaaacaggtggagttggcactgtgggacaca gcaggtcaggaagattatgatcgtttaagaccactctcctacccagacacggacgtcatc cttatgtgcttttctattgacagcccagacagtttagagaatattccagaaaagtggaca cccgaggtgaaacacttctgtcccaatgttcccatcattttggtggggaataaaaaggat ctacggaatgatgaacacacacggcgagagctggctaagatgaagcaggagcctgttaaa ccagaggagggcagggacatggctaaccgtattagcgcctttggctacctggagtgttca gccaagactaaggagggcgtgagggaagtgtttgaaatggcaactagggcagcactgcag gtccggaagaagaggaagaggagtggatgcttgatcttgtga

DBGET integrated database retrieval system