Astyanax mexicanus (Mexican tetra): 103037223 Help Entry 103037223         CDS       T05042                                  Symbol rab7b Name (RefSeq) ras-related protein Rab-7b   KO K07897   Ras-related protein Rab-7A Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04137   Mitophagy - animal amex04140   Autophagy - animal amex04144   Endocytosis amex04145   Phagosome amex04148   Efferocytosis amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103037223 (rab7b)    04145 Phagosome     103037223 (rab7b)    04140 Autophagy - animal     103037223 (rab7b)    04137 Mitophagy - animal     103037223 (rab7b)    04148 Efferocytosis     103037223 (rab7b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103037223 (rab7b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amex04131]     103037223 (rab7b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103037223 (rab7b)    04031 GTP-binding proteins [BR:amex04031]     103037223 (rab7b) Membrane trafficking [BR:amex04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103037223 (rab7b) Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103037223 (rab7b)   Exosomal proteins of other body fluids (saliva and urine)    103037223 (rab7b)   Exosomal proteins of colorectal cancer cells    103037223 (rab7b)   Exosomal proteins of bladder cancer cells    103037223 (rab7b) GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103037223 (rab7b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 PduV-EutP nSTAND3 AAA_16 Septin AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha ATPase_2 AAA_5 ATP-synt_ab ABC_tran SRPRB AAA_14 NACHT DAP3 MCM Motif Other DBs NCBI-GeneID:  103037223 NCBI-ProteinID:  XP_007235549 Ensembl:  ENSAMXG00000031957 UniProt:  A0A3B1JH45 A0A8T2LKJ1 LinkDB All DBs Position 12:complement(26726319..26737265) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV EPYDFPDQIKLRDDRPASSSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgcaaaaaggtgctgctgaaagtgatcatcctcggggactctggggttggg aagacctctttgatgaaccagtatgttaataataagttcagcaaccagtacaaggccaca atcggtgcagacttcctgaccaaagaggttatggtcgacgacaggcttgtcaccatgcag atttgggacacagcagggcaggagcgtttccagtctctgggagtggcgttctacagggga gcagactgctgtgtgctggtgtacgacgtcacagccccgaacacgttcaagactctggac agctggagggatgagtttctgatccaggccagccctcgcgaccctgagaacttccccttt gtggtgcttggaaataagattgacttggagaacagacaggttacaacaaagcgagctcag gcttggtgtcaaagcaagaacaatattccctattttgagaccagtgccaaagaagcaatc aacgtggaccaggctttccagaccattgctcgcaatgcactcaaacaggagtctgaagtg gagccatacgatttccccgaccagatcaaactacgagatgatagacccgcctcctccagc gacggctgcagctgctga

DBGET integrated database retrieval system