Astyanax mexicanus (Mexican tetra): 103040504 Help Entry 103040504         CDS       T05042                                  Symbol dbi Name (RefSeq) acyl-CoA-binding protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:amex00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     103040504 (dbi)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amex04052]     103040504 (dbi) Cytokines and neuropeptides [BR:amex04052]  Neuropeptides   Unclassified    103040504 (dbi) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACBP FERM_M Motif Other DBs NCBI-GeneID:  103040504 NCBI-ProteinID:  XP_007261106 Ensembl:  ENSAMXG00000041202 UniProt:  A0A8B9KLN4 A0A3B1IXM0 LinkDB All DBs Position 11:complement(34883863..34890925) Genome browser AA seq 87 aa AA seqDB search MSEEAFQKAAEEVKQLKAKPTDAEMLEIYSLFKQATVGDVNTARPGMLDFTGKAKWDAWD AKKGMSQEDARKAYISKVEELKGLYGI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggaagcttttcagaaggcagcggaagaggtgaagcagctgaaggcaaagcca actgacgctgagatgcttgagatttacagtttgttcaaacaggccaccgtaggcgacgtc aacactgctcgccctggcatgctggacttcactggaaaagccaagtgggacgcctgggat gcaaagaaaggcatgagccaggaggatgcaagaaaggcctacatcagtaaggtggaggag ctaaaaggactttatggaatctaa

DBGET integrated database retrieval system