Astyanax mexicanus (Mexican tetra): 103043048 Help Entry 103043048         CDS       T05042                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04137   Mitophagy - animal amex04140   Autophagy - animal amex04144   Endocytosis amex04145   Phagosome amex04148   Efferocytosis amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103043048 (rab7a)    04145 Phagosome     103043048 (rab7a)    04140 Autophagy - animal     103043048 (rab7a)    04137 Mitophagy - animal     103043048 (rab7a)    04148 Efferocytosis     103043048 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103043048 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amex04131]     103043048 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103043048 (rab7a)    04031 GTP-binding proteins [BR:amex04031]     103043048 (rab7a) Membrane trafficking [BR:amex04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103043048 (rab7a) Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103043048 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    103043048 (rab7a)   Exosomal proteins of colorectal cancer cells    103043048 (rab7a)   Exosomal proteins of bladder cancer cells    103043048 (rab7a) GTP-binding proteins [BR:amex04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103043048 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  103043048 NCBI-ProteinID:  XP_007256486 Ensembl:  ENSAMXG00000032027 UniProt:  A0A8B9LG11 A0A3B1JRC0 LinkDB All DBs Position 24:28048273..28063349 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcgaggaagaaagttctactgaaggtcatcatccttggagactcaggagtgggg aagacttcgctgatgaaccagtatgtgaacaaaaagtttagcaatcagtacaaagccaca ataggagccgatttcctgacgaaagaggtgatggtggacgaccgactcgtcacaatgcag atttgggacacagcaggtcaagagcgtttccagtctttgggcgtggcattctaccgtggt gcagattgttgcgtgctagtctttgacgtcacagcacccaacacatttaagacactggac agctggagggacgagttcttgatccaggccagcccgcgtgaccctgagaacttccccttc gttgtgctcggcaacaaaatcgacctagagaatcggcaggtaaccaccaagagggcacaa gcctggtgccagagcaagaacaacatcccgtactttgagaccagcgccaaggaggccatc aacgtagaacaagctttccagactattgcacgcaatgcactgaaacaggaaactgaagtg gagttgtacaacgagtttccagaacccatcaagctggacagaaacgatagagccaagcca tcagcagagacctgcagctgctga

DBGET integrated database retrieval system