Astyanax mexicanus (Mexican tetra): 103047037 Help Entry 103047037         CDS       T05042                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism amex  Astyanax mexicanus (Mexican tetra) Brite KEGG Orthology (KO) [BR:amex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:amex03041]     103047037 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amex04052]     103047037 (ubl5) Spliceosome [BR:amex03041]  Complex B   Other components    Complex B specific factors     103047037 (ubl5) Cytokines and neuropeptides [BR:amex04052]  Neuropeptides   Unclassified    103047037 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  103047037 NCBI-ProteinID:  XP_007238400 Ensembl:  ENSAMXG00000029668 UniProt:  A0A3B1IJF9 A0A8B9HS72 LinkDB All DBs Position 21:complement(41054172..41056337) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgtgtaacgaccggctgggtaaaaaggtccgggtcaagtgcaactct gaggacacgattggagatctgaagaagctgatcgctgctcagaccggcacacgatgggac aaaatcgttctgaagaaatggtatacaatattcaaggatcatgtgacactgggagactat gagatccatgatgggatgaacctggagctttattaccagtag

DBGET integrated database retrieval system