Astyanax mexicanus (Mexican tetra): 107197617 Help Entry 107197617         CDS       T05042                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism amex  Astyanax mexicanus (Mexican tetra) Brite KEGG Orthology (KO) [BR:amex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:amex03019]     107197617    03029 Mitochondrial biogenesis [BR:amex03029]     107197617 Messenger RNA biogenesis [BR:amex03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      107197617 Mitochondrial biogenesis [BR:amex03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     107197617 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  107197617 NCBI-ProteinID:  XP_015461262 UniProt:  A0A8B9RFV0 LinkDB All DBs Position 9:22510980..22511613 Genome browser AA seq 60 aa AA seqDB search MDPCDCAKTGSCNCGASCKCTNCQCTTCQKSCCPCCPSGCSKCASGCVCKGNACGSSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccctgtgactgcgccaagaccggaagctgcaactgtggtgcaagctgcaaatgc acaaactgccagtgtacaacatgccagaaaagctgctgcccatgctgtccgtctggctgc agcaagtgtgcttctggatgtgtgtgcaaaggcaatgcctgtggctccagttgctgccag tga

DBGET integrated database retrieval system