Astyanax mexicanus (Mexican tetra): 107197618 Help Entry 107197618         CDS       T05042                                  Name (RefSeq) metallothionein   KO K14739   metallothionein 1/2 Organism amex  Astyanax mexicanus (Mexican tetra) Brite KEGG Orthology (KO) [BR:amex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:amex03019]     107197618    03029 Mitochondrial biogenesis [BR:amex03029]     107197618 Messenger RNA biogenesis [BR:amex03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      107197618 Mitochondrial biogenesis [BR:amex03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     107197618 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  107197618 NCBI-ProteinID:  XP_015461266 LinkDB All DBs Position 9:complement(22505635..22506288) Genome browser AA seq 60 aa AA seqDB search MDPCDCTKTGSCSCGTSCKCTNCQCTCCQKSCCSCCPSGCSKCASGCVCKGNACDSSCCK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccatgtgactgcaccaagactggaagctgcagctgtggtacaagttgcaaatgc acaaattgccagtgcacatgctgccagaaaagctgctgctcatgctgtccgtctggctgc agcaagtgtgcttctggatgtgtgtgcaagggcaatgcctgtgattccagctgctgcaag tga

DBGET integrated database retrieval system