Astyanax mexicanus (Mexican tetra): 107197753 Help Entry 107197753         CDS       T05042                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04080   Neuroactive ligand-receptor interaction amex04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:amex00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     107197753 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     107197753 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amex04052]     107197753 (apln) Cytokines and neuropeptides [BR:amex04052]  Neuropeptides   GPCR binding    107197753 (apln) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin LYRIC Motif Other DBs NCBI-GeneID:  107197753 NCBI-ProteinID:  XP_015462639 UniProt:  W5JY37 LinkDB All DBs Position 10:49008351..49055544 Genome browser AA seq 77 aa AA seqDB search MNVKILTLVIVLLVSLLCSACAGPMASTEHSKELEEVGSMRTPLRQNQARAGRSQRPSSW RRRRPRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgttggtgattgtgctgctggtttctctgctgtgttcagcc tgtgctggtccaatggcctccaccgagcatagcaaggagctggaggaggtggggagcatg cggactccactccggcagaaccaggcccgagccgggcggagccaaagaccctccagctgg aggaggagacgccctcggcctcgcctgtcccacaagggacccatgccgttttag

DBGET integrated database retrieval system