Astyanax mexicanus (Mexican tetra): 111193433 Help Entry 111193433         CDS       T05042                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04382   Cornified envelope formation amex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amex00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     111193433 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111193433 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     111193433 (s100a10b) Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of microglial cells    111193433 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 DEK_C NNH2 Motif Other DBs NCBI-GeneID:  111193433 NCBI-ProteinID:  XP_022529941 Ensembl:  ENSAMXG00000039293 UniProt:  A0A3B1K915 LinkDB All DBs Position 6:2786484..2791055 Genome browser AA seq 98 aa AA seqDB search MPTDLERSMESLITVFHRYADKEGNSNTLSRRELRQLIESELPTFLKSQKDPATVDKIMK DLDANGDGEVSFEEFVSLVVGLSIACEQCYQLHKKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccgactgacctggagagatctatggaatccctgatcacggttttccaccgttacgcc gataaagaaggcaacagcaacacactgagccgcagggaactcagacagctcatcgagtcc gagctccccaccttccttaagtctcagaaagaccccgccacagtggataagatcatgaag gatctggacgctaatggagacggagaggtcagctttgaggagtttgtgtctctggtggtc ggcctgtccatcgcctgtgaacagtgctaccagctgcacaagaaaggaaagaagtga

DBGET integrated database retrieval system