Acropora millepora: 114969829 Help Entry 114969829         CDS       T06134                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism amil  Acropora millepora Pathway amil03420   Nucleotide excision repair amil04120   Ubiquitin mediated proteolysis amil04141   Protein processing in endoplasmic reticulum amil04310   Wnt signaling pathway amil04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:amil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114969829    04120 Ubiquitin mediated proteolysis     114969829   09124 Replication and repair    03420 Nucleotide excision repair     114969829  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     114969829    04350 TGF-beta signaling pathway     114969829  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amil04121]     114969829    03400 DNA repair and recombination proteins [BR:amil03400]     114969829 Enzymes [BR:amil01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114969829 Ubiquitin system [BR:amil04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114969829   Multi subunit type E3    SCF complex     Ring finger protein      114969829    Cul2 complex      114969829    Cul3 complex      114969829    Cul4 complex      114969829    Cul7 complex      114969829    Cul8 complex      114969829    Cul9 complex      114969829 DNA repair and recombination proteins [BR:amil03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114969829     TCR (transcription coupled repair) factors      Cul4-CSA complex       114969829 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  114969829 NCBI-ProteinID:  XP_029205989 LinkDB All DBs Position 5:24155482..24160876 Genome browser AA seq 112 aa AA seqDB search MAEPEGMEVDSTSVASTSAGAVKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC QANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggcggaacccgagggaatggaagtcgattccacttcggtagcatccacttctgcaggt gcagtcaagaaaagattcgaagtgaaaaagtggaatgccgtagcgctttgggcctgggat attgtggtggacaactgcgctatctgtcgcaaccatatcatggatttatgcatagaatgc caagcaaatcaggcttcagctacaagtgaagaatgcacagttgcatggggtgtttgtaat catgcttttcacttccattgtatctcacgctggctcaagactcgccaagtttgtccacta gacaacagagagtgggaattccaaaagtacggccgctaa

DBGET integrated database retrieval system