Ailuropoda melanoleuca (giant panda): 100468516 Help Entry 100468516         CDS       T01329                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01522   Endocrine resistance aml01524   Platinum drug resistance aml04010   MAPK signaling pathway aml04071   Sphingolipid signaling pathway aml04110   Cell cycle aml04115   p53 signaling pathway aml04137   Mitophagy - animal aml04151   PI3K-Akt signaling pathway aml04210   Apoptosis aml04211   Longevity regulating pathway aml04216   Ferroptosis aml04218   Cellular senescence aml04310   Wnt signaling pathway aml04722   Neurotrophin signaling pathway aml04919   Thyroid hormone signaling pathway aml05012   Parkinson disease aml05014   Amyotrophic lateral sclerosis aml05016   Huntington disease aml05160   Hepatitis C aml05161   Hepatitis B aml05162   Measles aml05163   Human cytomegalovirus infection aml05165   Human papillomavirus infection aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05168   Herpes simplex virus 1 infection aml05169   Epstein-Barr virus infection aml05200   Pathways in cancer aml05202   Transcriptional misregulation in cancer aml05203   Viral carcinogenesis aml05205   Proteoglycans in cancer aml05206   MicroRNAs in cancer aml05210   Colorectal cancer aml05212   Pancreatic cancer aml05213   Endometrial cancer aml05214   Glioma aml05215   Prostate cancer aml05216   Thyroid cancer aml05217   Basal cell carcinoma aml05218   Melanoma aml05219   Bladder cancer aml05220   Chronic myeloid leukemia aml05222   Small cell lung cancer aml05223   Non-small cell lung cancer aml05224   Breast cancer aml05225   Hepatocellular carcinoma aml05226   Gastric cancer aml05230   Central carbon metabolism in cancer aml05417   Lipid and atherosclerosis aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100468516 (TP53)    04310 Wnt signaling pathway     100468516 (TP53)    04071 Sphingolipid signaling pathway     100468516 (TP53)    04151 PI3K-Akt signaling pathway     100468516 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100468516 (TP53)   09143 Cell growth and death    04110 Cell cycle     100468516 (TP53)    04210 Apoptosis     100468516 (TP53)    04216 Ferroptosis     100468516 (TP53)    04115 p53 signaling pathway     100468516 (TP53)    04218 Cellular senescence     100468516 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100468516 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100468516 (TP53)   09149 Aging    04211 Longevity regulating pathway     100468516 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100468516 (TP53)    05202 Transcriptional misregulation in cancer     100468516 (TP53)    05206 MicroRNAs in cancer     100468516 (TP53)    05205 Proteoglycans in cancer     100468516 (TP53)    05203 Viral carcinogenesis     100468516 (TP53)    05230 Central carbon metabolism in cancer     100468516 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     100468516 (TP53)    05212 Pancreatic cancer     100468516 (TP53)    05225 Hepatocellular carcinoma     100468516 (TP53)    05226 Gastric cancer     100468516 (TP53)    05214 Glioma     100468516 (TP53)    05216 Thyroid cancer     100468516 (TP53)    05220 Chronic myeloid leukemia     100468516 (TP53)    05217 Basal cell carcinoma     100468516 (TP53)    05218 Melanoma     100468516 (TP53)    05219 Bladder cancer     100468516 (TP53)    05215 Prostate cancer     100468516 (TP53)    05213 Endometrial cancer     100468516 (TP53)    05224 Breast cancer     100468516 (TP53)    05222 Small cell lung cancer     100468516 (TP53)    05223 Non-small cell lung cancer     100468516 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100468516 (TP53)    05161 Hepatitis B     100468516 (TP53)    05160 Hepatitis C     100468516 (TP53)    05162 Measles     100468516 (TP53)    05168 Herpes simplex virus 1 infection     100468516 (TP53)    05163 Human cytomegalovirus infection     100468516 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     100468516 (TP53)    05169 Epstein-Barr virus infection     100468516 (TP53)    05165 Human papillomavirus infection     100468516 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     100468516 (TP53)    05014 Amyotrophic lateral sclerosis     100468516 (TP53)    05016 Huntington disease     100468516 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100468516 (TP53)    05418 Fluid shear stress and atherosclerosis     100468516 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100468516 (TP53)    01522 Endocrine resistance     100468516 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aml03000]     100468516 (TP53)    03036 Chromosome and associated proteins [BR:aml03036]     100468516 (TP53)    03400 DNA repair and recombination proteins [BR:aml03400]     100468516 (TP53) Transcription factors [BR:aml03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100468516 (TP53) Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100468516 (TP53) DNA repair and recombination proteins [BR:aml03400]  Eukaryotic type   Check point factors    Other check point factors     100468516 (TP53) SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  100468516 NCBI-ProteinID:  XP_002924483 Ensembl:  ENSAMEG00000016851 LinkDB All DBs Position 17 Genome browser AA seq 381 aa AA seqDB search MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPGVDELLLSEGVVNWMDEGSDDT PRMPVAPAPAAPGPAISWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKL FCQLAKTCPVQLWVNSPPPPDTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTVHYNYMCNSSCMGGMNRRPIL TIITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPSPELPPGSTKRALPPST SCSPPQKKKPLDGEYFTLQIRGRERFNMFRELNEALELKDALSGKEPGGSRAHSSHLKAK KGQSTSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgcaggacccacagtcggagctcaccatcgacccccctctgagccaggagacattttcc gaattgtggaacctacttcctgaaaacaatgttctgtcttccgagctgtccccaggagtg gatgaactgctgctctcagaaggcgtcgtgaactggatggacgaaggttcagatgacact cccaggatgccagtggctcctgcccctgcggcccctggaccagccatctcctggcccctg tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtctggggttc ctgcattccgggacagccaagtctgttacttgcacgtactccccctccctcaacaagctg ttttgccagctggcaaagacctgccccgtgcagctgtgggtcaactccccgcccccaccc gacacctgcgtccgcgccatggccatttataagaagtcggagttcgtgacagaggttgtg cggcgctgtccccaccatgagcgctgctctgacagtagtgatgggctggccccgcctcag catctcatccgggtggaaggaaacttgcgtgccaagtacttggacgacagaaacactttc cgacatagcgtggtggtgccctatgagccgcccgaggtcggctctgactgtaccaccgtc cactataactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc accatcatcaccctggaagattccagtggtaatgtgctgggacggagcagctttgaggta cgtgtctgtgcctgtcctgggagagaccggcgcacagaggaggagaatttccgtaagaag ggggagccttcccccgagctgccccccggaagcactaagcgagcactgcctcccagcacc agctgctctcccccacaaaagaagaagccactggatggggaatatttcacccttcagatc cgtgggcgtgaacgtttcaatatgttcagggagctgaatgaggccttggagctgaaggat gccctgagtggcaaggagccgggggggagcagggctcactccagccacctgaaggctaag aaggggcagtctacctcccgccataaaaagctgatgttcaagagagagggacccgactca gactga

DBGET integrated database retrieval system