Ailuropoda melanoleuca (giant panda): 100471490 Help Entry 100471490         CDS       T01329                                  Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04062   Chemokine signaling pathway aml04064   NF-kappa B signaling pathway aml04621   NOD-like receptor signaling pathway aml04657   IL-17 signaling pathway aml04668   TNF signaling pathway aml04936   Alcoholic liver disease aml05134   Legionellosis aml05146   Amoebiasis aml05167   Kaposi sarcoma-associated herpesvirus infection aml05323   Rheumatoid arthritis aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100471490    04668 TNF signaling pathway     100471490   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100471490    04061 Viral protein interaction with cytokine and cytokine receptor     100471490  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100471490    04657 IL-17 signaling pathway     100471490    04062 Chemokine signaling pathway     100471490  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100471490   09171 Infectious disease: bacterial    05134 Legionellosis     100471490   09174 Infectious disease: parasitic    05146 Amoebiasis     100471490   09163 Immune disease    05323 Rheumatoid arthritis     100471490   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100471490   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100471490  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100471490 Cytokines and neuropeptides [BR:aml04052]  Cytokines   Chemokines    100471490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Lipoprotein_9 Motif Other DBs NCBI-GeneID:  100471490 NCBI-ProteinID:  XP_034527584 LinkDB All DBs Position 11:complement(52887670..52889718) Genome browser AA seq 107 aa AA seqDB search MARAATPAAPRALRLLGAALLLLLLVPAGRRAAGAPVVAELRCQCLQTLQGIHLKNIQNV KVTPSGPHCAQTEVIATLKDGQEVCLNPEAPMVKRIINKMLNNGSTN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgccacccccgccgcaccccgcgccctccggctcctcggcgccgcgctg ctgctcctgctcctggtccccgccggccgccgcgccgcaggggcgcccgtggtcgccgaa ctgcgctgccagtgcttgcagaccttgcagggaattcacctcaagaacatccagaatgtc aaggtgacgccgtcgggaccccactgcgcccaaaccgaagtcatagccactctcaaggat ggacaggaggtgtgtctcaaccccgaagcccccatggtcaagagaatcatcaataagatg ctgaacaatggcagcaccaactga

DBGET integrated database retrieval system