Ailuropoda melanoleuca (giant panda): 100477151 Help Entry 100477151         CDS       T01329                                  Symbol IL6 Name (RefSeq) interleukin-6 precursor   KO K05405   interleukin 6 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01521   EGFR tyrosine kinase inhibitor resistance aml01523   Antifolate resistance aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04066   HIF-1 signaling pathway aml04068   FoxO signaling pathway aml04151   PI3K-Akt signaling pathway aml04218   Cellular senescence aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04623   Cytosolic DNA-sensing pathway aml04625   C-type lectin receptor signaling pathway aml04630   JAK-STAT signaling pathway aml04640   Hematopoietic cell lineage aml04657   IL-17 signaling pathway aml04659   Th17 cell differentiation aml04668   TNF signaling pathway aml04672   Intestinal immune network for IgA production aml04931   Insulin resistance aml04932   Non-alcoholic fatty liver disease aml04933   AGE-RAGE signaling pathway in diabetic complications aml04936   Alcoholic liver disease aml05010   Alzheimer disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05132   Salmonella infection aml05133   Pertussis aml05134   Legionellosis aml05135   Yersinia infection aml05142   Chagas disease aml05143   African trypanosomiasis aml05144   Malaria aml05146   Amoebiasis aml05152   Tuberculosis aml05161   Hepatitis B aml05162   Measles aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05168   Herpes simplex virus 1 infection aml05169   Epstein-Barr virus infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05202   Transcriptional misregulation in cancer aml05321   Inflammatory bowel disease aml05323   Rheumatoid arthritis aml05332   Graft-versus-host disease aml05410   Hypertrophic cardiomyopathy aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100477151 (IL6)    04668 TNF signaling pathway     100477151 (IL6)    04066 HIF-1 signaling pathway     100477151 (IL6)    04068 FoxO signaling pathway     100477151 (IL6)    04151 PI3K-Akt signaling pathway     100477151 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100477151 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     100477151 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100477151 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100477151 (IL6)    04620 Toll-like receptor signaling pathway     100477151 (IL6)    04621 NOD-like receptor signaling pathway     100477151 (IL6)    04623 Cytosolic DNA-sensing pathway     100477151 (IL6)    04625 C-type lectin receptor signaling pathway     100477151 (IL6)    04659 Th17 cell differentiation     100477151 (IL6)    04657 IL-17 signaling pathway     100477151 (IL6)    04672 Intestinal immune network for IgA production     100477151 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100477151 (IL6)    05202 Transcriptional misregulation in cancer     100477151 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100477151 (IL6)    05161 Hepatitis B     100477151 (IL6)    05171 Coronavirus disease - COVID-19     100477151 (IL6)    05164 Influenza A     100477151 (IL6)    05162 Measles     100477151 (IL6)    05168 Herpes simplex virus 1 infection     100477151 (IL6)    05163 Human cytomegalovirus infection     100477151 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     100477151 (IL6)    05169 Epstein-Barr virus infection     100477151 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     100477151 (IL6)    05135 Yersinia infection     100477151 (IL6)    05133 Pertussis     100477151 (IL6)    05134 Legionellosis     100477151 (IL6)    05152 Tuberculosis     100477151 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     100477151 (IL6)    05144 Malaria     100477151 (IL6)    05142 Chagas disease     100477151 (IL6)    05143 African trypanosomiasis     100477151 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     100477151 (IL6)    05321 Inflammatory bowel disease     100477151 (IL6)    05332 Graft-versus-host disease     100477151 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     100477151 (IL6)    05020 Prion disease     100477151 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     100477151 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100477151 (IL6)    05410 Hypertrophic cardiomyopathy     100477151 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100477151 (IL6)    04932 Non-alcoholic fatty liver disease     100477151 (IL6)    04931 Insulin resistance     100477151 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     100477151 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100477151 (IL6)    01523 Antifolate resistance     100477151 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100477151 (IL6) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interleukins    100477151 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 GCSF IL23 IL11 Motif Other DBs NCBI-GeneID:  100477151 NCBI-ProteinID:  NP_001291851 Ensembl:  ENSAMEG00000003313 UniProt:  H2DL91 LinkDB All DBs Position 1:160787404..160791233 Genome browser AA seq 211 aa AA seqDB search MNSLSTSAFSPVAFSLGLLLVMATALPTPGHLGRDSKDEATSNRPPLISADKMEIIKYIL GRISALKKEMCDKYNKCEDSKEALAENNLHLPKLAKKDGCFQSGFNQDTCLTRIATGLLE FQVHLKYLQANYEGDKENANSVYFSTKVLLQMLMEKVKNQDEVTTPDPTTDTGLQAILKS QDKWLKQTTIHLILRNLEDFLQFSLRAVRVM NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgaactccctctccacaagcgccttcagtccagttgccttctccctggggctgctcctg gtgatggctactgctctccctaccccgggacacctgggaagagattccaaagatgaggcc acctcaaatagaccaccactcatctctgcagacaaaatggaaatcattaaatacatcctc ggcagaatctctgcactgaaaaaggagatgtgtgacaagtataacaagtgtgaagacagc aaggaggcactggcagaaaataacttacatcttccaaaactggcaaaaaaggacggatgc ttccaatctgggttcaatcaggacacctgcctgacaagaatcgctaccggtcttctggag tttcaggtacacctgaaatacctccaggccaactatgaaggtgataaggaaaatgccaac tctgtgtacttcagtaccaaagtcctgctccagatgctgatggaaaaggtaaagaatcag gatgaagtgaccacccccgaccccaccacagacaccggcctgcaggctatcctgaagtcg caggacaagtggctgaagcaaacaacaattcacctcatcctgcggaaccttgaggatttc ctgcagttcagcctgagggctgtgcgggtcatgtag

DBGET integrated database retrieval system