Ailuropoda melanoleuca (giant panda): 100480240 Help Entry 100480240         CDS       T01329                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04024   cAMP signaling pathway aml04062   Chemokine signaling pathway aml04510   Focal adhesion aml04520   Adherens junction aml04611   Platelet activation aml04670   Leukocyte transendothelial migration aml04720   Long-term potentiation aml04722   Neurotrophin signaling pathway aml04934   Cushing syndrome aml04972   Pancreatic secretion aml05211   Renal cell carcinoma aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100480240 (RAP1B)    04014 Ras signaling pathway     100480240 (RAP1B)    04015 Rap1 signaling pathway     100480240 (RAP1B)    04024 cAMP signaling pathway     100480240 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100480240 (RAP1B)    04520 Adherens junction     100480240 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100480240 (RAP1B)    04670 Leukocyte transendothelial migration     100480240 (RAP1B)    04062 Chemokine signaling pathway     100480240 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     100480240 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     100480240 (RAP1B)    04722 Neurotrophin signaling pathway     100480240 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     100480240 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100480240 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100480240 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100480240 (RAP1B)    04031 GTP-binding proteins [BR:aml04031]     100480240 (RAP1B) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100480240 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    100480240 (RAP1B)   Exosomal proteins of colorectal cancer cells    100480240 (RAP1B) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     100480240 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  100480240 NCBI-ProteinID:  XP_011222080 Ensembl:  ENSAMEG00000008637 UniProt:  A0A7N5JJA8 LinkDB All DBs Position 15:43717881..43729612 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKIRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataaactagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttac agaaagcaagttgaagtagacgcacagcagtgtatgcttgagatcttggatactgcagga acggaacaatttactgcaatgagagacttatacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagatccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system