Ailuropoda melanoleuca (giant panda): 100481236 Help Entry 100481236         CDS       T01329                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01522   Endocrine resistance aml04110   Cell cycle aml04115   p53 signaling pathway aml04151   PI3K-Akt signaling pathway aml04218   Cellular senescence aml04530   Tight junction aml04660   T cell receptor signaling pathway aml04933   AGE-RAGE signaling pathway in diabetic complications aml04934   Cushing syndrome aml05160   Hepatitis C aml05162   Measles aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05165   Human papillomavirus infection aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05169   Epstein-Barr virus infection aml05200   Pathways in cancer aml05203   Viral carcinogenesis aml05212   Pancreatic cancer aml05214   Glioma aml05218   Melanoma aml05219   Bladder cancer aml05220   Chronic myeloid leukemia aml05222   Small cell lung cancer aml05223   Non-small cell lung cancer aml05224   Breast cancer aml05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100481236 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100481236 (CDK4)    04115 p53 signaling pathway     100481236 (CDK4)    04218 Cellular senescence     100481236 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     100481236 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100481236 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100481236 (CDK4)    05203 Viral carcinogenesis     100481236 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     100481236 (CDK4)    05225 Hepatocellular carcinoma     100481236 (CDK4)    05214 Glioma     100481236 (CDK4)    05220 Chronic myeloid leukemia     100481236 (CDK4)    05218 Melanoma     100481236 (CDK4)    05219 Bladder cancer     100481236 (CDK4)    05224 Breast cancer     100481236 (CDK4)    05222 Small cell lung cancer     100481236 (CDK4)    05223 Non-small cell lung cancer     100481236 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100481236 (CDK4)    05160 Hepatitis C     100481236 (CDK4)    05164 Influenza A     100481236 (CDK4)    05162 Measles     100481236 (CDK4)    05163 Human cytomegalovirus infection     100481236 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     100481236 (CDK4)    05169 Epstein-Barr virus infection     100481236 (CDK4)    05165 Human papillomavirus infection     100481236 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100481236 (CDK4)    04934 Cushing syndrome     100481236 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100481236 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:aml01001]     100481236 (CDK4) Enzymes [BR:aml01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100481236 (CDK4) Protein kinases [BR:aml01001]  Serine/threonine kinases: CMGC group   CDK family    100481236 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  100481236 NCBI-ProteinID:  XP_002916069 Ensembl:  ENSAMEG00000005351 UniProt:  D2H394 LinkDB All DBs Position 15:complement(34750149..34753005) Genome browser AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLMLEMLTFNPHKRISAFRALQHSYLQKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctactcctcgatatgagccagtggctgagattggtgttggtgcctatggaacggta tacaaggcccgtgatcctcacagcggccacttcgtggccctcaagagcgtaagagtccct aatggaggaggtgctggagggggccttcccatcagcacagttcgtgaggtggccttactg cggcggctggaggcttttgagcatcccaacgtcgtccggctgatggatgtctgtgccacc gcccgaactgaccgggagaccaaagtgactctggtgtttgagcacgtggaccaagacctg aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac ctgaagccagagaacattctcgtgaccagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat cgtgctccagaagttcttctgcagtctacatacgcaacacccgtggacatgtggagtgtt ggctgtatcttcgcagagatgtttcgtcgaaagcccctcttctgtggaaactctgaagct gaccagttaggcaaaatcttcgacctgatcgggctgcccccagaggatgactggccccga gatgtgtctctgccccgaggagccttttcccccagagggccccgcccagtgcagtcagtg gtacctgagttggaggagtctggagcacaactgatgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt aacccagagtga

DBGET integrated database retrieval system