Ailuropoda melanoleuca (giant panda): 117800361 Help Entry 117800361         CDS       T01329                                  Name (RefSeq) actin, cytoplasmic 1-like   KO K05692   actin beta/gamma 1 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml03082   ATP-dependent chromatin remodeling aml04015   Rap1 signaling pathway aml04145   Phagocytosis aml04210   Apoptosis aml04390   Hippo signaling pathway aml04510   Focal adhesion aml04517   IgSF CAM signaling aml04518   Integrin signaling aml04519   Cadherin signaling aml04520   Adherens junction aml04530   Tight junction aml04611   Platelet activation aml04613   Neutrophil extracellular trap formation aml04670   Leukocyte transendothelial migration aml04714   Thermogenesis aml04810   Regulation of actin cytoskeleton aml04814   Motor proteins aml04820   Cytoskeleton in muscle cells aml04919   Thyroid hormone signaling pathway aml04921   Oxytocin signaling pathway aml04971   Gastric acid secretion aml05014   Amyotrophic lateral sclerosis aml05100   Bacterial invasion of epithelial cells aml05132   Salmonella infection aml05135   Yersinia infection aml05164   Influenza A aml05205   Proteoglycans in cancer aml05225   Hepatocellular carcinoma aml05410   Hypertrophic cardiomyopathy aml05412   Arrhythmogenic right ventricular cardiomyopathy aml05414   Dilated cardiomyopathy aml05416   Viral myocarditis aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     117800361  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     117800361    04390 Hippo signaling pathway     117800361   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     117800361    04518 Integrin signaling     117800361    04519 Cadherin signaling     117800361  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     117800361   09143 Cell growth and death    04210 Apoptosis     117800361   09144 Cellular community - eukaryotes    04510 Focal adhesion     117800361    04520 Adherens junction     117800361    04530 Tight junction     117800361   09142 Cell motility    04814 Motor proteins     117800361    04820 Cytoskeleton in muscle cells     117800361    04810 Regulation of actin cytoskeleton     117800361  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     117800361    04613 Neutrophil extracellular trap formation     117800361    04670 Leukocyte transendothelial migration     117800361   09152 Endocrine system    04921 Oxytocin signaling pathway     117800361    04919 Thyroid hormone signaling pathway     117800361   09154 Digestive system    04971 Gastric acid secretion     117800361   09159 Environmental adaptation    04714 Thermogenesis     117800361  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     117800361   09162 Cancer: specific types    05225 Hepatocellular carcinoma     117800361   09172 Infectious disease: viral    05164 Influenza A     117800361   09171 Infectious disease: bacterial    05132 Salmonella infection     117800361    05135 Yersinia infection     117800361    05100 Bacterial invasion of epithelial cells     117800361   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     117800361   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     117800361    05410 Hypertrophic cardiomyopathy     117800361    05412 Arrhythmogenic right ventricular cardiomyopathy     117800361    05414 Dilated cardiomyopathy     117800361    05416 Viral myocarditis     117800361  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:aml03021]     117800361    03019 Messenger RNA biogenesis [BR:aml03019]     117800361    03036 Chromosome and associated proteins [BR:aml03036]     117800361    03029 Mitochondrial biogenesis [BR:aml03029]     117800361   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     117800361    04147 Exosome [BR:aml04147]     117800361 Transcription machinery [BR:aml03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      117800361 Messenger RNA biogenesis [BR:aml03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      117800361 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      117800361     NuA4 complex      117800361   Chromatin remodeling factors    BAF complex     117800361    PBAF complex     117800361    GBAF(ncBAF) complex     117800361    SWR1 complex     117800361 Mitochondrial biogenesis [BR:aml03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     117800361 Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      117800361 Exosome [BR:aml04147]  Exosomal proteins   Proteins found in most exosomes    117800361 SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  117800361 NCBI-ProteinID:  XP_034508786 Ensembl:  ENSAMEG00000027651 UniProt:  A0A7N5JVE1 LinkDB All DBs Position Unknown AA seq 360 aa AA seqDB search MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA IQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE RGYSFTTTAEREIVRDLKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF RCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQK EITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atgtgcaaggccggctttgctggagatgatgcaccacgtgctgtcttcccatccattgtt gggcggccaagacatcagggtgtgatggttggcatggggcagaaagatagctacgttggt gatgaagctcagagcaagaggggtatcctgaccctgaagtaccccattgaacacggtatt gtcaccaactgggatgatatggagaagatctggcaccacaccttctacaatgagcttcgt gttgcacctgaagagcaccctgttctgcttacggaagctccactgaaccctaaagccaac agagaaaagatgacccagatcatgtttgagaccttcaacaccccagccatgtatgtggct atccaggctgtgttgtccctgtatgcctcgggtcgtaccactggtattgtgatggactct ggcgatggtgtcacccacacagtaccaatctatgaaggttatgccctgcctcatgccatc ttgcgtcttgatctggctggtcgtgacctgacagactacctcatgaagatcctgacggag aggggctacagcttcacaactacagctgaaagagaaatcgtgcgtgatctgaaagagaaa ctatgctatgtcgctctggactttgagcaggaaatggccactgctgcttcctcgtcttca ttggagaaaagctatgaattgcctgacggtcaggtaatcaccattggcaatgagcggttt aggtgcccagaagccctcttccagccatccttccttggtatggagtcctgcggtattcat gaaactacctacaactctatcatgaagtgtgatgttgacatccgcaaagacctgtatgca aacactgtgctgtctggtggctccacaatgtacccaggcattgcagacagaatgcagaaa gaaattacagccctggcaccaagcacaatgaaaattaagatcattgcaccccctgagcgc aagtactccgtctggattggcggttctatcctggcatccctgtctaccttccaacagatg tggatcagtaagcaggagtacgatgaatctggtccttcaatcgtccaccgcaaatgcttc taa

DBGET integrated database retrieval system