Ailuropoda melanoleuca (giant panda): 117803984 Help Entry 117803984         CDS       T01329                                  Name (RefSeq) interleukin-6-like   KO K05405   interleukin 6 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01521   EGFR tyrosine kinase inhibitor resistance aml01523   Antifolate resistance aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04066   HIF-1 signaling pathway aml04068   FoxO signaling pathway aml04151   PI3K-Akt signaling pathway aml04218   Cellular senescence aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04623   Cytosolic DNA-sensing pathway aml04625   C-type lectin receptor signaling pathway aml04630   JAK-STAT signaling pathway aml04640   Hematopoietic cell lineage aml04657   IL-17 signaling pathway aml04659   Th17 cell differentiation aml04668   TNF signaling pathway aml04672   Intestinal immune network for IgA production aml04931   Insulin resistance aml04932   Non-alcoholic fatty liver disease aml04933   AGE-RAGE signaling pathway in diabetic complications aml04936   Alcoholic liver disease aml05010   Alzheimer disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05132   Salmonella infection aml05133   Pertussis aml05134   Legionellosis aml05135   Yersinia infection aml05142   Chagas disease aml05143   African trypanosomiasis aml05144   Malaria aml05146   Amoebiasis aml05152   Tuberculosis aml05161   Hepatitis B aml05162   Measles aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05168   Herpes simplex virus 1 infection aml05169   Epstein-Barr virus infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05202   Transcriptional misregulation in cancer aml05321   Inflammatory bowel disease aml05323   Rheumatoid arthritis aml05332   Graft-versus-host disease aml05410   Hypertrophic cardiomyopathy aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     117803984    04668 TNF signaling pathway     117803984    04066 HIF-1 signaling pathway     117803984    04068 FoxO signaling pathway     117803984    04151 PI3K-Akt signaling pathway     117803984   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117803984    04061 Viral protein interaction with cytokine and cytokine receptor     117803984  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     117803984  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     117803984    04620 Toll-like receptor signaling pathway     117803984    04621 NOD-like receptor signaling pathway     117803984    04623 Cytosolic DNA-sensing pathway     117803984    04625 C-type lectin receptor signaling pathway     117803984    04659 Th17 cell differentiation     117803984    04657 IL-17 signaling pathway     117803984    04672 Intestinal immune network for IgA production     117803984  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     117803984    05202 Transcriptional misregulation in cancer     117803984   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     117803984    05161 Hepatitis B     117803984    05171 Coronavirus disease - COVID-19     117803984    05164 Influenza A     117803984    05162 Measles     117803984    05168 Herpes simplex virus 1 infection     117803984    05163 Human cytomegalovirus infection     117803984    05167 Kaposi sarcoma-associated herpesvirus infection     117803984    05169 Epstein-Barr virus infection     117803984   09171 Infectious disease: bacterial    05132 Salmonella infection     117803984    05135 Yersinia infection     117803984    05133 Pertussis     117803984    05134 Legionellosis     117803984    05152 Tuberculosis     117803984   09174 Infectious disease: parasitic    05146 Amoebiasis     117803984    05144 Malaria     117803984    05142 Chagas disease     117803984    05143 African trypanosomiasis     117803984   09163 Immune disease    05323 Rheumatoid arthritis     117803984    05321 Inflammatory bowel disease     117803984    05332 Graft-versus-host disease     117803984   09164 Neurodegenerative disease    05010 Alzheimer disease     117803984    05020 Prion disease     117803984    05022 Pathways of neurodegeneration - multiple diseases     117803984   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     117803984    05410 Hypertrophic cardiomyopathy     117803984   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     117803984    04932 Non-alcoholic fatty liver disease     117803984    04931 Insulin resistance     117803984    04933 AGE-RAGE signaling pathway in diabetic complications     117803984   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     117803984    01523 Antifolate resistance     117803984  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     117803984 Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interleukins    117803984 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 GCSF IL11 IL23 Motif Other DBs NCBI-GeneID:  117803984 NCBI-ProteinID:  XP_034524981 Ensembl:  ENSAMEG00000003313 UniProt:  A0A7N5KHT0 LinkDB All DBs Position 1:160779175..160783610 Genome browser AA seq 240 aa AA seqDB search MRLGMSEAHSALEPTRNERELHLPSRTPAMNSLSTSAFSPVAFSLGLLLVMATALPTPGH LGRDSKDEATSNRPPLISADKMEIIKYILGRISALKKEMCDKYNKCEDSKEALAENNLHL PKLAEKDGCFQSGFNQDTCLTRIATGLLEFQVHLKYLQANYEGDKENANSVYFSTKVLLQ MLMEKVKNQDEVTTPDPTTDTGLQAILKSQDKWLKQTTIHLILRNLEDFLQFSLRAVRVM NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atgagactggggatgtctgaggctcattctgccctcgagcccaccaggaacgaaagagag ctccatctgccctccaggaccccagctatgaactccctctccacaagcgccttcagtcca gttgccttctccctggggctgctcctggtgatggctactgctctccctaccccgggacac ctgggaagagattccaaagatgaggccacctcaaatagaccaccactcatctctgcagac aaaatggaaatcattaaatacatcctcggcagaatctctgcactgaaaaaggagatgtgt gacaagtataacaagtgtgaagacagcaaggaggcactggcagaaaataacttacatctt ccaaaactggcagaaaaggacggatgcttccaatctgggttcaatcaggacacctgcctg acaagaatcgctaccggtcttctggagtttcaggtacacctgaaatacctccaggccaac tatgaaggtgataaggaaaatgccaactctgtgtacttcagtaccaaagtcctgctccag atgctgatggaaaaggtaaagaatcaggatgaagtgaccacccccgaccccaccacagac accggcctgcaggctatcctgaagtcgcaggacaagtggctgaagcaaacaacaattcac ctcatcctgcggaaccttgaggatttcctgcagttcagcctgagggctgtgcgggtcatg tag

DBGET integrated database retrieval system