Amycolatopsis mediterranei S699: RAM_20935 Help Entry RAM_20935         CDS       T01822                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism amn  Amycolatopsis mediterranei S699 Pathway amn00670   One carbon pool by folate amn00790   Folate biosynthesis amn01100   Metabolic pathways amn01240   Biosynthesis of cofactors amn04981   Folate transport and metabolism Module amn_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:amn00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RAM_20935    00670 One carbon pool by folate     RAM_20935  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     RAM_20935 Enzymes [BR:amn01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      RAM_20935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-ProteinID:  AEK42667 UniProt:  A0A9R0NXY2 LinkDB All DBs Position 4509364..4509822 Genome browser AA seq 152 aa AA seqDB search MIGLVWAQAANGVIGRDGELPWHLPEDLRHFKELTAGAAVVMGRRTWESLPPRFRPLPGR RNLVLSGTPQEGAETFADLPSALAAVPGDRWVIGGAAVYRAALPFADRIVVTEIRESFEG DTYAPEVGRPADSVGEWLESSAGLHYRFLTWG NT seq 459 nt NT seq  +upstreamnt  +downstreamnt gtgatcgggctggtctgggcgcaggcggcgaacggggtcatcggacgggacggcgagctg ccctggcacctgccggaggacctgcggcacttcaaggagctgaccgcgggggcggcggtg gtgatgggccgccgcacgtgggagtcgctgccgccgcgcttccggccgctgccggggcgg cgcaacctcgtgctctcggggaccccgcaggagggcgccgagacgttcgcggacctgccg tcggcgctcgccgcggtgcccggcgaccggtgggtgatcggcggcgcggcggtgtaccgg gcggcgctgccgttcgcggaccggatcgtggtcacggagatccgggagtccttcgagggg gacacgtacgcgccggaggtcgggcggccggcggactccgtgggggagtggctggagtcc tcggccgggctgcactaccgcttcctgacctggggctga

DBGET integrated database retrieval system