Anopheles moucheti: 128301560 Help Entry 128301560         CDS       T09615                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism amou  Anopheles moucheti Pathway amou00510   N-Glycan biosynthesis amou00513   Various types of N-glycan biosynthesis amou04141   Protein processing in endoplasmic reticulum Module amou_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:amou00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     128301560    00513 Various types of N-glycan biosynthesis     128301560  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     128301560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF2269 TctB Phage_holin_2_1 Motif Other DBs NCBI-GeneID:  128301560 NCBI-ProteinID:  XP_052894070 LinkDB All DBs Position 3:complement(68873798..68874448) Genome browser AA seq 80 aa AA seqDB search MDLMVRYVSPVNPAVFPHLASVLLLFGTFFTAWFFVFEVSRPKQPSKESVIFKELAISLF ASLFLGFGVLFLLLSVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggatttgatggtgcgctacgtctcgccggtgaacccggccgtgtttccacatttggcc agcgtgttactgctgttcggcacattcttcacagcctggttcttcgtgttcgaagtatca cgcccgaaacaaccgtccaaggagagcgtaatcttcaaggagctggccatcagtttgttt gcatcgctgttccttggctttggtgtgctgtttcttctgctttcggttgggatttacgtg taa

DBGET integrated database retrieval system