Anopheles marshallii: 128714326 Help Entry 128714326         CDS       T10928                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism amrs  Anopheles marshallii Pathway amrs00510   N-Glycan biosynthesis amrs00513   Various types of N-glycan biosynthesis amrs04141   Protein processing in endoplasmic reticulum Module amrs_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:amrs00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     128714326    00513 Various types of N-glycan biosynthesis     128714326  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     128714326 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF2269 TctB Phage_holin_2_1 Motif Other DBs NCBI-GeneID:  128714326 NCBI-ProteinID:  XP_053665177 LinkDB All DBs Position 3:complement(62536901..62537143) Genome browser AA seq 80 aa AA seqDB search MDLMVRYVSPVNPAVFPHLASVLLLFGTFFTAWFFVFEVSRPKQPSKESVIFKELAISLF ASLFLGFGVLFLLLSVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggatttgatggtgcgctatgtctcgccggtgaacccggccgtgtttccacatttggcc agcgtgttactgctgttcggtacattcttcaccgcctggttcttcgtgttcgaagtatct cgcccgaaacaaccgtccaaggagagcgtaatcttcaaggagctggccatcagtttgttt gcatcgctgttccttgggtttggagtgctatttcttctgctttcggttgggatttacgtg taa

DBGET integrated database retrieval system