Amycolatopsis sp. DSM 110486: K1T34_15690 Help Entry K1T34_15690       CDS       T10626                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism amyd  Amycolatopsis sp. DSM 110486 Pathway amyd00670   One carbon pool by folate amyd00790   Folate biosynthesis amyd01100   Metabolic pathways amyd01240   Biosynthesis of cofactors amyd04981   Folate transport and metabolism Module amyd_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:amyd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     K1T34_15690    00670 One carbon pool by folate     K1T34_15690  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     K1T34_15690 Enzymes [BR:amyd01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      K1T34_15690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-ProteinID:  QYN23761 LinkDB All DBs Position complement(3219621..3220079) Genome browser AA seq 152 aa AA seqDB search MIGVEWAQSSNGVIGRDGALPWRLPEDLKHFRELTSGATVLMGRRTWESLPPRFRPLPGR RNLVLSRTPQEGVETFPELAQAFAAVSGDVWVMGGEAVYRAALPFADRIVVTEIQEHFEG DTYAPEVGRAPDSTGEWQESSTGLHYRLLTWG NT seq 459 nt NT seq  +upstreamnt  +downstreamnt gtgatcggggtcgaatgggcgcagtcgtccaacggtgtcatcggccgtgacggcgcgctg ccgtggcgcctgccggaggacctcaagcactttcgcgagctgacctcgggcgcgactgtg ctgatgggccgccggacctgggagtcactgccgccgaggttccggccgttgcccggccgg cgcaacctcgtactttcgcgcacgccgcaggaaggcgtcgagacgtttcccgaattggcg caggcgttcgccgcggtgtccggggacgtgtgggtgatgggcggcgaggccgtgtaccgg gcggcgctgccgttcgcagaccggatcgtggtcacggagatccaggagcacttcgagggc gacacgtacgcgcccgaggtcgggcgggcgccggactccaccggcgagtggcaggaatcg tcgacggggctgcactaccggttgctgacctggggctga

DBGET integrated database retrieval system